CAZyme Information: QYA_81074T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_81074T0-p1
• CAZy Family: GT62
• CAZyme Description: Glycoside hydrolase family 46 protein [Source:UniProtKB/TrEMBL;Acc:A0A162TA77]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157		17283.15	5.1303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC04:1117671-1118531(+)

Full Sequence      

MASLITNVFEDGDSNFAFASCSNIQDLRGFTSGYAGFTTGTGDSETLIQLYSQNHPNNRL
EQFLPRCHEISSLPHCDRQSRGTTQGLEQFCAAWKEEACDASGAFAKTQRQWVFENYMIP
SARYAAQNGVTSALGQAIFYVTKCGQQVLVEVQTSKA

Enzyme Prediction     

EC	3.2.1.132:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	4	142	4.6e-28	0.5945945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381600	chitosanase_GH46	2.18e-40	1	140	6	140	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.
396099	Glyco_hydro_46	1.34e-23	5	140	2	129	Glycosyl hydrolase family 46. This family are chitosanase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07538.1|GH46	3.02e-43	1	140	82	220
CDS12419.1|GH46	1.28e-25	1	142	94	235
QHM19891.1|GH46	8.79e-18	2	142	46	178
QDD67567.1|GH46	2.75e-17	2	142	11	143
QBO56277.1|GH46	3.84e-17	2	142	11	143

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7C6C_A	1.33e-18	2	142	11	143	Chain A, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]
7C6D_A	9.85e-18	2	142	11	143	Chain A, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]
6LWU_A	1.98e-12	1	140	10	141	Chain A, chitosanase [Gynuella sunshinyii YC6258],6X2Q_A Chain A, Chitosanase [Gynuella sunshinyii YC6258]
4OLT_A	2.88e-12	5	142	28	157	Chitosanase complex structure [Pseudomonas sp. LL2(2010)],4OLT_B Chitosanase complex structure [Pseudomonas sp. LL2(2010)]
4QWP_A	2.77e-11	5	142	28	157	co-crystal structure of chitosanase OU01 with substrate [Pseudomonas sp. A-01],4QWP_B co-crystal structure of chitosanase OU01 with substrate [Pseudomonas sp. A-01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O07921|CHIS_BACSU	1.14e-17	2	142	46	178	Chitosanase OS=Bacillus subtilis (strain 168) OX=224308 GN=csn PE=1 SV=1
sp|P33665|CHIS_STRSN	8.56e-07	23	140	77	184	Chitosanase OS=Streptomyces sp. (strain N174) OX=69019 GN=csn PE=1 SV=1
sp|P48846|CHIS_NOCSP	7.45e-06	23	140	78	184	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_81074T0-p1.