CAZyme Information: QYA_79895T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_79895T0-p1
• CAZy Family: GT59
• CAZyme Description: CBM21 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A162QQ31]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		48630.51	6.4586

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC03:2140697-2142077(+)

Full Sequence      

MTDIVFTARNASLRRVRLKPSLSNTALLYSSSNCYLNSTPIKNFVLPPPPPPPPCAYSSP
SSLNMTKSADRALKPSLRKMEVIGSESNAATAIIKSVHFNDPLTRVVHFYTPPSLDEYDE
DEEEETEEDEEEEEEEGKLEDAFLQLYMVHGLQDECDSLAIAQPPTSNSLATNSKANGSL
SLPNWPLTIHPARRFISQMVSLESLVWNHSLQVVQGRVLVHNLAFEKKITVRCSFDDWKT
WTDIDAYHKESAFHSGGLSDVNHHSAFDRFLFELHVSNVHAFSCDLAIRYQTLGQEFWDN
NNGNNFAVQSMPLGGSTLGEKPLSLFKAIMQPEHDNNSNNKEGLSIIPSSTLNVMEYPQG
SNHHHQESVNQKSCRHGSRDDIVSQQQQPTARKMTAKSRHLLDRSKFSKYGASKIPAAPV
PIYLNSKRVIATMH

Enzyme Prediction     

No EC number prediction in QYA_79895T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	198	308	2.6e-26	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	2.12e-28	194	309	1	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.26e-10	222	308	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB26447.1|CBM21	1.85e-14	180	363	384	573
AFR96516.1|CBM21	1.85e-14	180	363	384	573
UOH82924.1|CBM21	1.85e-14	180	363	384	573
AAW44639.2|CBM21	3.28e-14	180	363	384	573
AWU78113.1|CBM21	1.90e-13	183	350	290	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	4.79e-10	194	324	30	151	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9VVY3|GBS76_DROME	1.49e-12	198	324	529	647	Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
sp|Q7TMB3|PPR3C_MOUSE	2.92e-11	194	308	151	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q9UQK1|PPR3C_HUMAN	7.05e-11	167	308	123	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q5U2R5|PPR3C_RAT	1.27e-10	194	308	151	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	1.76e-09	208	308	161	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000001

TMHMM  Annotations     

There is no transmembrane helices in QYA_79895T0-p1.