CAZyme Information: QYA_37192.P1117

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_37192.P1117
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	McirCBS277-49_SC03|CGC10	52422.74	9.2653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC03:861039-862565(-)

Full Sequence      

MDALFSRLTFNKLCIAAFALRVVLLLYGEYQDAYFTVKYTDIDYVVFTDAARYITEGKSP
YLRETYRYTPLLAMLLTPNIFWFRSFGKCLFASADLLCGYLIHRILVLRGMPSKSALKFD
ALWLLNPMVANISTRGNAESLLGVMVLGTFYLVLTRRYFYSACLVFGLSVHFKIYPVIYA
IPLLMLLDDHYGNPFQQSSFLVKVQHVRFRIIHELDQQLAEKDSITTKIVKGTIVFLSPV
RILFGLISAFVFFALTASMYQQYGDEFMQHTYLYHVTREDHRHNFSIWFYQMYLGIDNTS
PWMGLVAFVPQLALVTLIGIAFGKDLFFAAFMQTFIFVTFNKVITSQYFMWYICLFPLIL
PSSRIKFRWKGLLLLLAWVAGQGLWLNFAYQLEFLGQNTFLQLWIAGVTFFIANCWIVVE
LILNHQYEPIYGSSGRIRWVWGNGDPGSKRSL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	132	422	7.2e-96	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	4.07e-130	8	431	6	424	GPI mannosyltransferase
252941	Mannosyl_trans	7.78e-79	132	422	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07286.1|GT50	7.86e-209	9	452	7	486
AWP20910.1|GT50	1.06e-117	1	426	1	401
CBN81774.1|GT50	7.76e-115	1	426	1	401
AAH81324.1|GT50	1.56e-113	17	428	21	412
CAJ83771.1|GT50	1.56e-113	17	428	21	412

PDB Hits     

QYA_37192.P1117 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66IJ4|PIGM_XENTR	2.77e-114	17	428	21	412	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1
sp|Q5EA10|PIGM_BOVIN	3.56e-113	15	430	23	416	GPI mannosyltransferase 1 OS=Bos taurus OX=9913 GN=PIGM PE=2 SV=1
sp|Q9H3S5|PIGM_HUMAN	7.13e-113	17	430	25	416	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	7.13e-113	17	430	25	416	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	6.46e-111	17	430	25	416	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000001

TMHMM  Annotations     

Start	End
13	30
66	83
90	112
132	154
159	181
233	255
301	323
343	365
372	391
401	423