CAZyme Information: QYA_200207.P208

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_200207.P208
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1133	McirCBS277-49_SC01|CGC17	126707.28	5.9462

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC01:4861134-4865209(+)

Full Sequence      

MKGSASDLRRSTEALLTNSSAWDIPDTHTDHDSDTKVTSEKPDEIRQLLAEATGAKIEES
VTASSSDSSVANDTSIEDRLKSVFHLPAKESLRGEWPCYIVQSAIVPGFMYLTDNHICFY
ASLPKSQLVFHKSGYLQLKKAGKMKSTFERYFFDVNDDVLTWFESSTDSYSPLGKIDLKY
AIAVRQSTKRKYGFRVVTMNKTWHFQADTNAAVIEWTNALQKAIFRAKNNGSSLKITLPF
ENILDIEQTEAFEFQKFLKIRAVGIDDSFVMDEYYFAYFSDIETTFNRLKLAWESYSRDT
AIAAAADAGGGIAVEADKLHSLTPDHDSSNNSPSLSISDLYDADSQPITIPAASSAGSIP
APPKRSNSVVANALAVPGALKDFLYPSASSSKSTAASDKLQESSSSDDDDPSVGWLHGKR
RSGMKLVYGLLGGNTMIGSPSTALATDDEDDEDDEEEDDEEEHYRLDTVSSPRADEAEVL
DDRTMTNFQKYFVLPESEKLLAVYRCSLMKTLPCYGKLYISSSYVSFNAKGFATKAKMII
PFQDVIRIQKLRSRGYIFHSLSILTQTKKEIYLEFSSITRRNSCFAKLFLQHKRALESQT
EPGKAEKKIKDWEARLMEDEQKDAIGRVVPNDASLPVLSRQQTETIVYKKPEKSLHFTCI
TIGTRGDVQPYIALCKGLMKEGHRCRIATHDEFKDWIEEHGIEFRTVGGDPGELMRICVE
NNFFSVNFVVEGLRLFKDWIDELLTLSWKAVQGTEIIIESPSAMIGVHMAEALRVPYFRS
FPMPMTRTRSFPHPFATPNNPKGRLYNDMTYVLFDHAVWRAIAARTNAFRKTTLGIPATS
YEKLEVWKIPYLYSFSPSIVPSPLDWLDWIHCTGYWFLDNPQTGWTPDPELKAFIEASDA
RPIVYIGFGSIIVSDPVGITRVIIESVLLSNVRAIVSRGWSSRHKQGAVSEEADMLSRHP
GTIMSVQSVPHDWLFPKIRAVVHHGGAGTTAAGLRAGRPTIIKPFFADQFFWGERVEEMG
IGRCIKNLTVDNLSAALRVVSTDENMLKVANRVGQKIRAETGVDTAIQCIYRDMELAKAR
TMSSIHKTSKADDDAMASSFGEEDQDWTIIEEVTSGSTSPGSWKPTDTEAKKS

Enzyme Prediction     

EC	2.4.1.173:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	657	1070	6.9e-55	0.9738219895287958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.78e-70	655	1068	1	399	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.78e-51	660	1066	7	391	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
275402	PH-GRAM1_AGT26	2.36e-32	110	224	1	116	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
397255	Glyco_transf_28	5.94e-29	660	792	4	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
275403	PH-GRAM2_AGT26	2.45e-23	497	588	1	92	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 2. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11938.1|GT1	0.0	95	1125	4	981
CDS03727.1|GT1	1.71e-248	69	1078	95	1210
QRW14842.1|GT1	2.61e-235	62	1114	328	1404
QRV86273.1|GT1	7.24e-235	62	1114	328	1404
QRW00323.1|GT1	7.45e-234	62	1094	328	1394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	9.63e-137	650	1110	15	478	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.85e-136	650	1110	35	498	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.58e-26	661	1060	7	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	7.96e-26	663	1042	9	351	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	5.12e-19	663	1073	9	402	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CKU4|ATG26_ASPTN	4.15e-224	79	1114	238	1364	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
sp|A7KAN4|ATG26_PENRW	7.64e-222	67	1114	223	1349	Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=atg26 PE=3 SV=1
sp|A2QNQ5|ATG26_ASPNC	2.98e-220	79	1114	242	1362	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2
sp|Q4WID6|ATG26_ASPFU	3.46e-216	71	1114	227	1368	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|A1CFB3|ATG26_ASPCL	3.54e-216	64	1110	220	1369	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in QYA_200207.P208.