CAZyme Information: QYA_187400T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_187400T0-p1
• CAZy Family: GT3
• CAZyme Description: Dolichyl-diphosphooligosaccharide--protein glycotransferase [Source:UniProtKB/TrEMBL;Acc:A0A168IYH6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744	McirCBS277-49_SC07|CGC5	84283.96	8.9134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC07:2626848-2630112(+)

Full Sequence      

MATLDVSSQKILLKRAILGLIAVVAFSSRLFSIVRYESIIHEFDPWFNYRATRMLVKDGF
YEFWNWFDDRSWYPLGRVVGGTIYPGLMVTAAIIHNILHYFHFPVDIRNICVLLAPMFSG
LTAFATYLLTKELKDSSAGLLAAVFMGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIK
ALKLGSALWASAAAFFYFYMVAAWGGYVFIINIIPLHVFVLMLMGRFSSRVYVSYSTFYI
LGTLMSMQIPFVGFQPTRTSEHMAALGVFGLCQIMGFVNLMRSHLQTKQFQILLKAFVAV
TFVLGFAALVGLTLGGYIAPWTGRFYSLWDTGYAKIHIPIIASVSEHQPTAWPMFFFDLQ
MLIFVFPVGIYLCFQTLRDEHVFVIVYGIFASYFAGVMVRLMLTLTPVVCICGGMAISTL
LDTYLDFSNTDTAATAAATPSSGASEEKKKKPSAAAAAKDKKNKVFGIIANDTRIIVVST
FVFFLFMFVWHCTWVTSNAYSSPSVVLASRNPDGSQRIIDDFREAYYWLRKNTDEDAKIM
SWWDYGYQIAGFSNRTTLVDNNTWNNTHIATVGRAMSTNEADSYEIMKKHDVNYVLVIFG
GLLGYSGDDINKFLWMIRIAQGIWPDKIKESDFFTAQGEYRVDDQASQAMKDSLMYKMSY
YRFNEVFGGRQPYDRVRNQPLPMKGPELSVLDEAFTSENWIVRIYKVKDYDNLGRDHHEA
MAFEAGNKKVKAKRIPRATTPGTL

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	14	666	5.7e-196	0.8513708513708513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	1.77e-149	12	501	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	5.56e-102	6	715	12	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	1.25e-30	17	597	1	586	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
224720	ArnT	9.68e-05	10	195	2	171	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
404170	PMT_2	1.68e-04	113	226	26	135	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11103.1|GT66	0.0	1	731	1	731
QRW02713.1|GT66	0.0	6	740	15	749
QRV73765.1|GT66	0.0	6	740	15	749
ATZ46879.1|GT66	0.0	13	737	22	748
CCD48580.1|GT66	0.0	13	737	22	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	2.19e-308	12	731	15	706	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	1.78e-292	12	740	71	802	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6S7O_A	3.33e-292	4	714	9	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTG_5	1.35e-291	4	714	9	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	2.61e-289	4	709	9	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	1.31e-312	10	736	21	749	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	1.13e-307	12	731	15	706	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|E2RG47|STT3B_CANLF	4.55e-292	12	740	71	802	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	9.14e-292	12	740	71	802	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|P46977|STT3A_HUMAN	1.71e-291	4	714	9	701	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000002

TMHMM  Annotations     

Start	End
12	34
81	103
110	129
139	158
165	182
197	219
231	253
263	285
297	319
352	374
381	399
403	425
475	497