CAZyme Information: QYA_168848.P449

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_168848.P449
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1157		130830.84	9.7899

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC01:2661015-2664899(-)

Full Sequence      

MSNPNNRSGGYRPDPRLSQSPYAMRPPSSSPQMQHQQQQSRGRVQSYGMDQFNRPRPPPH
NQQQQQQQRRPPSHQQQQPQPQSRQSGNYMYQSSRQPSPQRMPQGGARPMRPPQQQPMVP
PGPMGGQGPYRRVSMNRSRSLSRPERQRPRQGMIRSPSQQQRLQQQQRYYMQQQQQPGAG
YPQQRPRPNNYPMPNRLQSQLQQQKMQQQQQQQQEALLNQPQQQQQQQKKPPVPEEKVKV
LTSWWAWLAFLMTCCIPNWFLRVCLRKRNAMVQQAWREKLSLCYIILLLCGALAFITYGL
NKTLCPTPDVNSPFSRVTNGARIPVYYSDVRVFGTIYPMDAMKLFFQNKGMNLTNDYENT
DISSIFDGDTTGACAKYPSMKLTNCALNNPYGGTFPAPNNTCFSLAELQRFFRSSAVLGF
DWQDLNKNLVYGRGLTLVVLNLTKYLSNPTPPFGPDVDRAIRNNLANDLSYALLYSQAGK
DARKCLVARYKVGIMETETGGCIADSMIMTLMLVVIIVMIVIRYSMALLFQWFISRRLTK
PGGRSNWLAWRSIKGGNNDPANHIPGPYNNYGVVQNASSTSLGSGSSRNTPFSEQSSAVG
LGGAQSDIVTTELYTVMLVTCYSEGEEGLRITMDSLAETTFSKKHKIFFVIADGMITGHG
ETKSTPDIVVSMMDLDPTMTNPKPASYLAIADGEKQLNMAKVYAGHYKGVPCITIVKCGT
EEEANLPKAGNRGKRDSQLILMSYFQRVLFNDRLSELDYEIFWKMTWLMKGVTPDKFELV
LMVDADTKVLPDALTYMVAAMANDITIMGLCGETRIANKRSSWVTAIQVFEYYISHHYAK
AFESLFGIVTCLPGCFSMYRIKSPKNGAWVPILANPDIILEYNQNVVTTLHEKNLLLLGE
DRFLSTLMLRTFPRRQMMFVPQARCKTVVPDEFKVLLSQRRRWINSTVHNLMELVLVSDL
CGIACLSMQFSVFIDLIGTLVLPAAIVMTVYLIVNTAISSDPQWQSLALLIAILGLPAVL
IAITTFKFIYVLWMIVYLIALPIWNLVLPLYSFWHFDDFSWGATRVVVGEKKGDSHGDAD
GKFDPTRLVMKKWEDWETERTGQKFNKKMTLKTPLDSPAAFDGKNTITPATVSSFGTIFN
DRKMFGASPAPTITSSQ

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	608	1099	4.9e-241	0.9620493358633776

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	612	1099	24	527	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	2.48e-88	618	950	2	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	1.01e-20	776	860	78	162	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.04e-19	767	1059	128	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404520	Glyco_tranf_2_3	4.73e-09	776	946	87	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10376.1|GT2	0.0	117	1156	69	1115
CDS03254.1|GT2	0.0	130	1148	137	1171
CDS10247.1|GT2	0.0	446	1155	1	704
CDS07743.1|GT2	3.48e-241	272	1100	123	944
AZQ26802.1|GT2	2.20e-233	246	1100	69	944

PDB Hits     

QYA_168848.P449 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13356|CHS1_CRYNH	1.15e-229	233	1100	63	957	Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS1 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	7.59e-223	236	1104	74	958	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1
sp|Q01285|CHS4_NEUCR	3.14e-213	243	1100	209	1190	Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-4 PE=3 SV=3
sp|P78611|CHSD_EMENI	1.11e-212	236	1100	179	1168	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
sp|P30573|CHS3_CANAX	1.70e-209	273	1100	194	1162	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
244	261
281	300
508	530
972	994
1004	1026
1033	1055