CAZyme Information: QYA_164315.P1022

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_164315.P1022
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	McirCBS277-49_SC05|CGC17	52946.25	8.1703

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC05:2341749-2343255(-)

Full Sequence      

MDTASTKKGLSGGVHQINSWFDQLLPQASLLPHQQQQQESTKHTILKSRWFRLSVVVYIL
FSILLTAAHVASWLFSGPSSPSHFHHTSRGAMDTLSYQRTYDADEAYSLLSNMSHGLKMS
KLFAQGHYDALKYVQPFWQRAASVPEPQQVSFIVTTTPNTWRDLVQMAKNWNGPISATLH
ISSKHDKHVLTTIEAEYKAKPELFQNVDLHLVETPNGIEKMASIMVPVNVERNLARIYAR
TDHVSDVPFNIVIATDLRQTLEKNQARYTQLLSQGDMLVIPTFQYDSQQQLSQMQIPQTK
KELVGLVEGEHLLGLYDAHFELNQGPTDFKKWKNADALYAVTDYTMDYEPVVIQSKTVQP
WCSERFVDKKSACLLSSYLAGNDFLVLPHDFAIQKPSNKKTAISDLDSVIEKRLYSKFYW
EQCVYQGRQLDALGLWNSKKSEHIRQQCSRVIQNWGRGLIGKPE

Enzyme Prediction     

No EC number prediction in QYA_164315.P1022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	141	415	3.6e-27	0.7893175074183977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.78e-26	164	421	16	321	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11928.1|GT49	5.26e-135	24	464	78	510
CDS07474.1|GT49	3.39e-134	16	464	81	525
CDS06192.1|GT49	5.74e-65	49	454	72	477
CDS14416.1|GT49	2.95e-63	108	452	128	482
CDS09884.1|GT49	3.48e-50	76	451	7	383

PDB Hits     

QYA_164315.P1022 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8N3Y3|LARG2_HUMAN	1.18e-09	145	404	427	674	Xylosyl- and glucuronyltransferase LARGE2 OS=Homo sapiens OX=9606 GN=LARGE2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999918	0.000089

TMHMM  Annotations     

Start	End
53	75