CAZyme Information: QYA_163885T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_163885T0-p1
• CAZy Family: GT2
• CAZyme Description: Glycoside hydrolase family 17 protein [Source:UniProtKB/TrEMBL;Acc:A0A168K2Z9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	McirCBS277-49_SC05|CGC3	30053.86	8.4041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC05:909314-910168(+)

Full Sequence      

MRFTSIITVALSFAGLVKALPIESRGVSSLNGVTYTARNSDGSCQSASQIVSSVKLMKSS
GVSKIRTYAQECESLPNILKAIKEVGGMTVLPGVWIDGTSNDDAEIARLQKVLNSADNTN
AITGILVGNEVIFNNIMSSSQLVGKLNQVKKIAKGIQVGTAEVDSTYTSDLMAASDFAGV
NIHPYFASASIKNAFSNLNQRYNTFKKSAGGKQVYITETGWPSSGAASGAAQPSLANTEA
FVTSLSASSLPYYYFEWEDSNWKGAGVESHFGLLNGQGNAKFAI

Enzyme Prediction     

EC	2.4.1.-:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	52	284	6.3e-25	0.9389067524115756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.33e-41	28	275	43	302	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.20e-15	32	284	2	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09972.1|GH17	9.30e-68	12	283	11	285
QNG13167.1|GH17	4.68e-25	33	275	237	492
CAG58735.1|GH17	4.77e-25	33	275	240	495
QHS65456.1|GH17	4.77e-25	33	275	240	495
UCS25029.1|GH17	4.86e-25	33	275	243	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.46e-24	25	284	32	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.04e-23	25	284	32	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	1.35e-24	1	284	1	308	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	4.65e-22	24	274	302	561	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|P53189|SCW11_YEAST	2.04e-21	33	274	284	538	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q5BD29|BTGE_EMENI	3.85e-21	32	275	296	553	Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgE PE=1 SV=1
sp|Q04951|SCW10_YEAST	7.28e-20	28	275	134	387	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999725	CS pos: 25-26. Pr: 0.8707

TMHMM  Annotations     

There is no transmembrane helices in QYA_163885T0-p1.