CAZyme Information: QYA_163810.P1059

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_163810.P1059
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	McirCBS277-49_SC05|CGC17	61642.68	5.3468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC05:661716-663495(+)

Full Sequence      

MKSTAFLSIVAAITAVTAQIQDSPFHWSDNQNVISPYATSGKMEAIGRTGVAAMHATLLN
EKTILIIDKAEWNEAQFDSGQSAFSVQYDLDTNTYRPLPLETNTFCSAGGFLSNGSFIST
GGGEKRGRNWKAEPGWQSIRHFTPCTDSSCLWEEYKTGKMTENRWYPTVEQLPEGDLFII
GGSTKGTAVNRQEINVPSYEFWPPRPEGEVNFKFLNETMPYNLYPFVFTLPDGNLFIFAN
KKSIIYDYNNQKVVKELPKIPGNPRSYPLTGGAIMLPLDPKNNYNVEILICGGSERMKNN
AAADDTCGRINLGDEDPQWKMETFVHKRLMPDGLIMADGNLLWANGCQRGWAGYNGRNHD
PTFDPLIYTPAAPAGKRWTQNLANTDIARMYHSVALTLPDGRIWIAGSNNVDPPDVNAEY
PTEFRVEYFSPPYLFKTKTRPLISHVPRVVTYGENFDILLNLDGLASSKEDAQKIRVGLL
RTGFSTHSMHMSQRYVFLEHEVSEDLQTLKVTAPPTAPIYPPGAGILYVLYDGVPSLGTE
IFVEHQASDLMI

Enzyme Prediction     

No EC number prediction in QYA_163810.P1059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	38	545	4.4e-178	0.955595026642984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	6.71e-84	54	293	1	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	6.58e-25	447	543	3	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	1.79e-24	438	543	4	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08707.1|AA5_1	9.58e-313	1	552	1	552
QRV97414.1|AA5_1	5.44e-113	43	548	142	665
QRW11955.1|AA5_1	7.66e-113	43	543	142	660
QRV83232.1|AA5_1	7.66e-113	43	543	142	660
QRW24733.1|AA5_1	6.54e-112	42	543	199	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	8.91e-19	153	536	245	607	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	4.54e-17	153	536	234	596	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	4.59e-17	153	536	239	601	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
1T2X_A	3.07e-14	164	543	270	637	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2EIC_A	5.37e-14	164	543	270	637	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	2.54e-88	49	543	35	549	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	4.14e-87	46	541	21	519	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	3.47e-84	49	541	105	612	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	1.81e-62	83	544	127	594	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.92e-48	79	541	457	901	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999727	CS pos: 18-19. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in QYA_163810.P1059.