CAZyme Information: QYA_158770T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_158770T0-p1
• CAZy Family: GT2
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A168Q201]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285	McirCBS277-49_SC01|CGC22	31431.05	4.4808

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC01:4011169-4012204(+)

Full Sequence      

MLVSYISAGLLAVSSALTVQARYIDYSAASTAAALFRRGDAPGCRNMNTNFAETTDGWVL
QKGSSEETYSITPEGLEMKILKPKEYEPTYEAAIDNDTPNKLRYNKYEGRGFTFNATTYM
QYGKFSATVKSAKVPGAVTAVILIADNGDEIDFELLAGPKQQITSNYFYGPHIVYGENGE
VIDAPKGSVFDQFYKYTIEWSPEKIVWKIDDEEIRTVTLAETDPKDGSEPAYPTHPARVQ
IGLWDGSGASGTAEWARGPIDWSKQDGPVTAYIKNVVIECDPQHN

Enzyme Prediction     

No EC number prediction in QYA_158770T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	106	261	1.1e-38	0.896551724137931

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	9.18e-47	108	280	33	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.22e-30	113	264	24	168	Glycosyl hydrolases family 16.
185684	GH16_lichenase	1.67e-19	46	276	7	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185683	Glyco_hydrolase_16	2.76e-19	111	262	57	206	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	4.78e-11	47	263	54	258	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10243.1|GH16	6.33e-75	37	285	26	270
CDS13191.1|GH16	1.09e-74	44	285	29	261
CDS12756.1|GH16	2.32e-39	109	285	2	141
VWO96434.1|GH16	8.64e-35	44	280	820	1052
QWW22589.1|CBM18|GH16_19	1.86e-32	90	279	102	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	2.72e-26	108	279	56	222	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3HR9_A	5.41e-08	120	264	16	154	Chain A, Beta-glucanase [Fibrobacter succinogenes]
3H0O_A	1.78e-07	120	264	15	153	Chain A, Beta-glucanase [Fibrobacter succinogenes]
3AXD_A	1.91e-07	121	264	19	156	The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase V18Y/W203Y in apo-form [Fibrobacter succinogenes subsp. succinogenes S85],3AXD_B The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase V18Y/W203Y in apo-form [Fibrobacter succinogenes subsp. succinogenes S85],3AXE_A The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase V18Y/W203Y in complex with cellotetraose (cellobiose density was observed) [Fibrobacter succinogenes subsp. succinogenes S85]
1ZM1_A	5.95e-07	120	264	15	153	Crystal structures of complex F. succinogenes 1,3-1,4-beta-D-glucanase and beta-1,3-1,4-cellotriose [Fibrobacter succinogenes],1ZM1_B Crystal structures of complex F. succinogenes 1,3-1,4-beta-D-glucanase and beta-1,3-1,4-cellotriose [Fibrobacter succinogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	1.78e-28	119	282	133	303	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AJC0|UTR2_CANAL	1.34e-25	111	276	129	298	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	1.13e-24	69	278	135	351	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q8J0P4|CRF1_ASPFU	1.61e-24	108	279	77	243	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|Q75A41|CRR1_ASHGO	1.10e-19	111	278	186	359	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000354	0.999613	CS pos: 21-22. Pr: 0.9679

TMHMM  Annotations     

There is no transmembrane helices in QYA_158770T0-p1.