CAZyme Information: QYA_158639T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_158639T0-p1
• CAZy Family: GT2
• CAZyme Description: Glyco_tran_10_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A162RSH7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		46157.74	4.9322

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC01:3555625-3557096(+)

Full Sequence      

MSTTLPPLKIVYATPWFGTRKFNENHWCTLTSTTDDMEDAAALLFHAPDTILSKLPDHTT
NQPWILESLETPFSSLFRADKEFMTNFNYLASYHFRSTFLFSYFSPAIMDVVNRPLPRDF
IKTKTKSAPILWIAKNCRATNGREKYIEKLMEYVDVHSYGDCLNNKPFPSDKSRTDLIAE
YKFYLSIENSNCQDYATEKLYDTLALSAVPIVDGPASYAGYIPTNRSVIYMDAYPDPKDL
ADYITYLHNNDTAYLEYLSFRQHAIDVAPKNRLEPEFISRWNDTMDFNQKSSYCSVCRGV
LPWWSYKSDPHQKLAYHDPDQANIFLVDDTCEASGKWNYIADGPPYQPSWTPRPRDEFTR
PDMTLPETTETTSNDTLTAMDQSQSQDAQAVANRVLVANRI

Enzyme Prediction     

EC	2.4.1.152:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	11	298	3.1e-65	0.829971181556196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	1.76e-46	124	263	1	139	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
407214	Glyco_tran_10_N	4.84e-04	6	103	2	108	Fucosyltransferase, N-terminal. This is the N-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03884.1|GT10	1.61e-104	68	361	2	289
CDS13017.1|GT10	2.62e-75	1	195	1	216
AFO96721.1|GT10	2.31e-34	52	262	4	226
UJR27602.1|GT10	1.12e-33	107	262	220	380
CAB1337694.1|GT10	2.12e-33	41	297	134	408

PDB Hits     

QYA_158639T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5F2N2|FUT11_ORYLA	3.19e-33	45	297	130	395	Alpha-(1,3)-fucosyltransferase 11 OS=Oryzias latipes OX=8090 GN=fut11 PE=2 SV=1
sp|Q70AG8|FUT11_TAKRU	4.21e-32	41	261	125	361	Alpha-(1,3)-fucosyltransferase 11 OS=Takifugu rubripes OX=31033 GN=fut11 PE=2 SV=1
sp|Q08C60|FUT11_DANRE	2.30e-31	45	297	112	377	Alpha-(1,3)-fucosyltransferase 11 OS=Danio rerio OX=7955 GN=fut11 PE=2 SV=1
sp|Q6A1G3|FUT10_XENTR	3.78e-31	28	300	97	387	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus tropicalis OX=8364 GN=fut10 PE=2 SV=1
sp|Q6NTZ6|FUT10_XENLA	6.96e-31	28	300	95	385	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_158639T0-p1.