CAZyme Information: QYA_155971.P910

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_155971.P910
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	McirCBS277-49_SC04|CGC9	46928.19	9.4130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC04:242039-243518(-)

Full Sequence      

MLKQVYSIAITSRLVTIGLAIATYFFTGSYDSSGEIQLETSAATSALNVFLRWDALYFLH
IAEKGYVYEQETAFFPVMPLLSRLLANTVFLPLQSLLGNRYTLLLSGVTVANVSFVLAVG
ALYKLTVAVLPKNKRLAHVSSIAFCLSPPAMFMSSFYTESIFALMTFTGMRWVIEKKYMQ
SALIWGIASAVRSNAIVYAGFFFYDLVWMRLIHRKNFVTGLLRSIVYTLMTASGFAFFQY
YAYKEFCSLDRPWCTEKVPLIYSFVQKEYWDVGFMSYYEIKQIPNFVLAAPIIALSVFGL
KAYIQHNSVEFWTLGIKRSKHNDSDSYYSSTLAVFMYLWAFLLLFATTNMHIQVIIRFFT
SVPPLYWYVGNLWIKGFCEGKHTWMANVVLGYFTIYGLIGIVLFSSFLPPA

Enzyme Prediction     

No EC number prediction in QYA_155971.P910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	8	411	3.3e-105	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.66e-62	3	411	2	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.04e-17	50	368	71	362	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09540.1|GT76	2.69e-136	2	411	4	392
BBN03197.1|GT76	1.28e-68	3	409	13	480
AHL38953.1|GT76	1.74e-61	9	409	21	487
NP_172652.2|GT76	1.74e-61	9	409	21	487
AAT85753.1|GT76	1.74e-61	9	409	21	487

PDB Hits     

QYA_155971.P910 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NUD9|PIGV_HUMAN	3.30e-56	3	409	9	491	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	6.83e-54	3	409	9	490	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.04e-51	3	409	9	491	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q4I0K3|GPI18_GIBZE	2.88e-47	30	411	38	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	8.62e-43	30	411	56	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993340	0.006669

TMHMM  Annotations     

Start	End
5	27
101	123
136	158
182	204
221	243
283	305
326	348
352	374
386	408