CAZyme Information: QYA_154662.P562

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_154662.P562
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		45212.06	4.5055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC01:164278-165996(+)

Full Sequence      

MKLFLQKLLTFGSIGLSSLLVAANAQQQKPFQNHNALDVSSILKQHDKPNTLEAHEKHFQ
GDTLAYVTPWNNRGYDIVKEFKGKFDYVSPVWYYIQRRSSMEFDLDGEHDVDQGWMKEVK
DESTNKGRILPRFQFRGWTGDDLRLFVSDKAESQALVDRLMDQVSKYNFDGVVIECGFPA
FFQVFLNQLSTQLHKDDRQLIVVLPAIMTEEHKKYMTPDIFKAMAQYVDRFSLMTYDFSS
HDPNGGPSSPIEWIMDNIEYLAPEPEERSKLLIGFNMYAMSYLPTRAPEPLVMKTVIEKL
RDQPKERMLDDELFDDDVPDEDGSTEVLNWDSASQEAWFVDIDEEGIRQGTVWLPTLRSI
KNRVRLAEDYGVGIALWEVGQGLDYYYDLF

Enzyme Prediction     

No EC number prediction in QYA_154662.P562.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	100	381	4.8e-30	0.7804054054054054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119355	GH18_SI-CLP	1.88e-100	59	390	1	318	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
119353	GH18_CFLE_spore_hydrolase	3.02e-25	63	381	4	304	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
214753	Glyco_18	3.61e-22	64	381	3	333	Glyco_18 domain.
226376	YaaH	3.72e-19	61	381	102	409	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
119349	GH18_chitinase-like	3.22e-17	65	237	3	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11651.1|GH0	4.07e-124	41	389	8	325
BAH13441.1|GH0	2.32e-68	17	389	61	422
AFI38071.1|GH0	5.74e-68	17	389	31	392
CAF32458.1|GH0	5.74e-68	17	389	31	392
CAV31088.1|GH0	5.74e-68	17	389	31	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BXW_A	1.98e-69	17	389	31	392	Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens],3BXW_B Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens]
4Q6T_A	3.32e-07	106	282	49	240	The crystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9BWS9|CHID1_HUMAN	1.02e-68	17	389	31	392	Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1 PE=1 SV=1
sp|Q5RFF6|CHID1_PONAB	1.44e-68	17	389	31	392	Chitinase domain-containing protein 1 OS=Pongo abelii OX=9601 GN=CHID1 PE=2 SV=1
sp|A0JPQ9|CHID1_RAT	7.95e-68	29	389	43	392	Chitinase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Chid1 PE=2 SV=2
sp|Q5EAB4|CHID1_BOVIN	1.58e-67	37	389	55	392	Chitinase domain-containing protein 1 OS=Bos taurus OX=9913 GN=CHID1 PE=2 SV=1
sp|Q922Q9|CHID1_MOUSE	1.58e-67	17	389	31	392	Chitinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Chid1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001077	0.998889	CS pos: 25-26. Pr: 0.9543

TMHMM  Annotations     

There is no transmembrane helices in QYA_154662.P562.