CAZyme Information: QYA_153524T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_153524T0-p1
• CAZy Family: GH5
• CAZyme Description: Glycosyltransferase family 62 protein [Source:UniProtKB/TrEMBL;Acc:A0A168JAT0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	McirCBS277-49_SC06|CGC1	40781.07	5.2795

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC06:972483-973774(-)

Full Sequence      

MEKMEKSTLKSSNPFSGFGRPNKRIILIGLFLLSFFSLGFVTFSRTWFSNPCSGEQVAFG
NEETNAGRATFIDLNQLQATAQSVSRQEKVLILTPLKNAAKYLPRYFELIDNMKYPKHLI
SIAFLVSDTTDDTVDILRSTADEFLNRDSDRYDSITIYEKDFKFDLPEDKRHNFELQPLR
RSYMARSRNYLLTAALRQDHAWVLWLDVDVIQYPDSILEDLQSVDVDVVVPNCLRETDDN
SFWGYDKNNWQETEESRAIQEQLDPVRYFEFLTRRYLMVDMPTHGNRLDKVPLDGVGATF
TLVKANVHREGANFPAYSYQHQVETEGFAKMAKAMGFGVYGLPAYLIYHINNS

Enzyme Prediction     

No EC number prediction in QYA_153524T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	70	318	3.5e-76	0.9776119402985075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	8.17e-120	70	318	3	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
133016	Succinoglycan_BP_ExoA	7.72e-04	89	146	1	58	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
133035	GT_2_like_e	0.002	92	143	1	52	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
132997	Glyco_tranf_GTA_type	0.005	92	233	1	115	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
224137	GT2	0.006	194	353	79	223	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13781.1|GT62	6.32e-164	1	353	1	363
CDS06949.1|GT62	2.97e-162	20	353	16	363
CDS03400.1|GT62	4.16e-153	71	353	44	335
CDR35719.1|GT62	2.03e-95	73	352	66	351
CDS05726.1|GT62	3.39e-84	25	350	12	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.15e-48	67	353	4	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	1.16e-61	23	350	34	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	5.62e-56	65	350	58	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O36022|MNN9_SCHPO	2.53e-52	33	351	13	336	Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnn9 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.54e-51	73	351	77	367	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|P39107|MNN9_YEAST	9.69e-48	67	353	94	393	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000036

TMHMM  Annotations     

Start	End
25	47