CAZyme Information: QYA_139789T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_139789T0-p1
• CAZy Family: GH18
• CAZyme Description: Glyco_transf_20 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A168M8P9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	McirCBS277-49_SC03|CGC18	95647.39	5.7125

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC03:1416741-1419566(-)

Full Sequence      

MPEISGRIINVTHQIPFHISRSSNGVSTIESDAPAPTPDNADDAAAPAVPPGRKASIWGL
EKEKKEEDPEIAAAPVSKLARHHVRSRTLRAKFRAAEWTIVQNRGHGALNAGLQSLNDEY
QTLHIGWTGPIKDESNKVTLPAEDLTDDDRTKIQDLLKKTGNIIPIFLDSKSRGHYEGYC
KEVLWPLFHYLVWTNDSDGRSEKQNWEDYVAVNRQFAETIAANYQPGDVIFINDYHLLLV
PEMLREKIPDAPIGLFLHATFPSSEIFRCLTTRKEVLQGFLGANLVGFQTYSYARHFIGA
CTRVLGCESTQTGVNVNGHIVSVGTFPIGIDANRVDQFRKEPAVAPKMKAIRDMYVGKKI
IIGRDKLDSTKGVLQKLHAFEKFLTDYPEWRKEVVLIQVTTPTYGDNSKLEAKVSEMVSH
INSKFGSLEFSPCHHYYQDVDRDEYYALLSVADVGLITSLRDGMNTTSLEYIICQQETHG
PLILSEFTGTAGSLSAALIVNPFDYAGVAKALNEALLMSPEDKLTRHTQLFDYVKEHSAA
FWAKSFVKQLVESTKNFSLQSQSTPALNTEQFIDNYKKANKRLMFFDYDGTLTPIVSVPT
DAKPFPEMLEYIQDLCNDPRNEVWVVSGRDQACLEDWLGGIKNLGLSAEHGCFLKAAGSD
VWTNVLENIDMSWKKDVTEIFDYYTERTEGSFVEHKKSSITWHYRMADEEYGLFQAKECQ
NHLESSVVSKMPVEILVGKKNLEVRPMMINKGEIVKKILAQSPDSDFIVCAGDDKTDEDM
FRTLSATFFAQYQDKLATEGASAKSWNDTKSNLYTITVGPSMKKSMANWQVETPTEIIQL
LGKMAETDKQQ

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	76	550	1.6e-165	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215556	PLN03064	0.0	107	789	122	810	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
184712	PRK14501	0.0	107	846	28	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	0.0	107	848	39	787	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	0.0	98	550	22	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
340820	GT20_TPS	0.0	93	550	14	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJH76892.1|GT20	0.0	1	849	19	834
CDS06611.1|GT20	0.0	1	845	24	872
CDS09548.1|GT20	0.0	2	845	16	834
CDS13004.1|GT20	0.0	98	847	46	778
CDS07232.1|GT20	2.71e-286	5	834	24	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	7.49e-138	98	547	57	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
6JBI_A	8.09e-116	107	550	28	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	2.08e-114	107	566	40	490	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	5.11e-114	107	560	32	477	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.99e-113	107	560	32	477	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	1.02e-198	97	842	35	844	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	4.00e-198	97	845	58	813	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54K57|TPSA_DICDI	9.84e-185	107	773	44	690	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9P4D3|TPS2_ZYGRO	1.82e-184	97	842	30	851	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	4.52e-180	166	784	128	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_139789T0-p1.