CAZyme Information: QYA_130546T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_130546T0-p1
• CAZy Family: GH152
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A162QG72]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	McirCBS277-49_SC05|CGC2	34222.95	5.5595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC05:405597-406608(+)

Full Sequence      

PKLVSLAHAAGTKVMVSVGGWSGSTQFSPMAASASNRAAWIKWNVDFVSKYGTDGVDIDW
EYPTAKGAGCNAVGDNDVANLNTLVKELRTALNSNFPNNYKEITMAVHITPWGGATDATD
VSAFVPYIDRFHVMSFDVNGAWNSTSGPNSPFHNQPGFGYPVGWAEGVEKWHSAGVPYNK
IAGGIAFYGRAQTLTVTSNPTTQYNPAVSPSPPLGDSLDGPWTNPYCSSDTSSASGVWRW
TNMRSQGLLTSPTTAASPWIRNFDNVTQTPWLYNPTNKQFISYDDPVSLGVKTNHALSKD
LAGLFVWSIEQDNGELL

Enzyme Prediction     

No EC number prediction in QYA_130546T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	7	314	6.9e-61	0.7736486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	1.91e-68	13	312	86	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	5.35e-68	7	312	62	334	Glyco_18 domain.
395573	Glyco_hydro_18	2.70e-57	2	312	55	307	Glycosyl hydrolases family 18.
225862	ChiA	5.21e-56	13	317	128	429	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	1.20e-55	13	312	72	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJD76187.1|GH18	3.47e-118	1	317	55	378
AMP42675.1|GH18	1.69e-117	1	317	88	411
CDS13735.1|GH18	5.90e-115	1	317	82	402
CDS06898.1|GH18	2.01e-112	1	317	81	405
ATY63066.1|GH18	6.06e-81	2	312	69	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	5.33e-47	3	315	49	358	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
3WL1_A	2.19e-37	11	313	79	360	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3WKZ_A	5.92e-37	11	313	79	360	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]
3WL0_A	1.60e-36	11	313	79	360	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain E148A mutant in complex with a(GlcNAc)2 [Ostrinia furnacalis]
3W4R_A	1.94e-36	11	313	97	378	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	2.20e-34	13	317	156	443	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|P36362|CHIT_MANSE	7.41e-32	13	313	97	376	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|A5FB63|CHIA_FLAJ1	9.88e-28	13	312	113	446	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
sp|Q11174|CHIT_CAEEL	1.83e-26	13	313	130	400	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	2.36e-24	13	313	91	364	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995682	0.004385

TMHMM  Annotations     

There is no transmembrane helices in QYA_130546T0-p1.