CAZyme Information: QYA_129990T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_129990T0-p1
• CAZy Family: GH152
• CAZyme Description: Glycosyltransferase family 71 protein [Source:UniProtKB/TrEMBL;Acc:A0A168PNC1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	McirCBS277-49_SC01|CGC14	30683.98	7.4357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC01:2098699-2099546(-)

Full Sequence      

RGILLCVGNNQFKFAATTIRAIREIFHNTLPIEVFFIRDADLHQAKRHYLKSEFQDVHLV
KLQDYVSDYYTQFGGWAMKPFAMLASRYTEVIMMDADVFYFQDPALLFEDEGYKATGSLF
YYDRTLFPNKTKGPDWMRSFLPSMSSFVPNSRWFKQESVHEQESGVVIMNKRKALLGLLS
TCKLNSKTEREEVVYKRVYGDKETFWIGFEVMQTPYAFVKSFAGVIGNHGRGGDDGSPDY
LCGNEIHFDANEKPLWLNGGLYRNK

Enzyme Prediction     

No EC number prediction in QYA_129990T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	1	244	3.5e-51	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.61e-41	1	249	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14050.1|GT71	9.68e-108	1	265	199	460
CDS05902.1|GT71	8.75e-106	1	265	201	462
UJR24360.1|GT71	6.80e-54	1	265	189	455
UJR24372.1|GT71	1.66e-51	1	258	181	440
CDR35835.1|GT71	6.15e-49	1	265	165	439

PDB Hits     

QYA_129990T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AGA0|MNN1_CANAL	9.66e-19	1	260	358	665	Putative alpha-1,3-mannosyltransferase MNN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN1 PE=2 SV=1
sp|Q59VL7|MNN15_CANAL	2.93e-16	1	260	265	577	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2
sp|P40549|MNT3_YEAST	1.01e-14	82	261	320	526	Alpha-1,3-mannosyltransferase MNT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT3 PE=1 SV=1
sp|Q59YS7|MNN14_CANAL	1.67e-12	1	227	276	519	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|P53745|MNT4_YEAST	3.83e-12	1	261	198	484	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_129990T0-p1.