CAZyme Information: QYA_128967T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_128967T0-p1
• CAZy Family: GH134
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A168P8J4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		47139.39	5.4190

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC01:47176-48411(-)

Full Sequence      

FDDSVQAHNFTPPLNKPFRYNAEDRIRGINLGGWLVLEPFITPKLFEQFGPNQTVIDEWS
LCERLGPEEAKRQLQHHYETFITEADFKRIAEMGFNHVRIPTGHWAVQVLADEPYVPFIS
WQYLLQGVQWARKYGLRVMVELHTAPGSQNGWNHSGKSGMVGFLNGTEGESNADRTLQIA
TEMIRFFDKPEWANVVPLFGVLNEPAMMKIPAVKVKSWYQSSYNAIRKLLGPGRGPLLTY
HDGFFPLNSWNGFFGKQYERVILETHLYMIFNNGLVSMPRAQQSEFPCTAWKKDIGEASI
HVGPTMVGEFSVATNDCAKYLNGVGLGARYDGTLEQEGAPTAPVCPTCTCEGVDDWTQFT
PEYKEFLLQFMEKQMDAYETGVGWFYWTYKTEDHVNPHWDYLLAWEQGYAPK

Enzyme Prediction     

No EC number prediction in QYA_128967T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	76	392	3.6e-109	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.24e-44	26	412	18	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.19e-09	79	228	22	156	Cellulase (glycosyl hydrolase family 5).
381626	GH113_mannanase-like	7.45e-04	84	155	22	96	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05746.1|GH5_9	6.77e-217	1	412	4	416
CDS04115.1|GH5_9	7.72e-201	1	412	124	536
CAP80421.1|GH5_9	2.02e-122	1	411	7	417
SMY19701.1|GH5_9	9.12e-120	1	412	317	738
SMQ46023.1|GH5_9	1.81e-119	1	412	317	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.20e-75	26	412	9	380	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	4.36e-75	26	412	9	380	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	5.16e-75	26	412	15	386	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	9.97e-75	26	412	14	385	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.44e-74	26	412	15	386	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CHZ8|EXGD_ASPTN	4.93e-121	1	412	403	815	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|A1DMX4|EXGD_NEOFI	8.87e-121	1	411	399	810	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	1.33e-119	1	411	398	809	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|Q4WMP0|EXGD_ASPFU	1.33e-119	1	411	398	809	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|A2QX52|EXGD_ASPNC	2.27e-116	1	412	396	807	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_128967T0-p1.