CAZyme Information: QYA_127973T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_127973T0-p1
• CAZy Family: GH125
• CAZyme Description: Mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A168JWW2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496	McirCBS277-49_SC05|CGC12	57533.57	8.9096

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC05:214800-216348(-)

Full Sequence      

IFVICLLFRLLNAFYTRTYDNPDEYWQGQEVAHELVFGNGYLTWEWREKIRSFAHPLAIA
MVYKLIQVVGLDSTHVLVAAPRYFQATLAAVADVATYTLAKKVIGNDIALSMLFTTLCSW
FNFLMAARTLSNSMEMVFTIIALNYWPLPGIVKTTGKSWVKRYRISLVFASIACVMRPTN
GLIWLFLGIQLLLCSSSRFKVASNAMLICGLVVALDVVVDTRLYNQGWTDFMRHLVFTPY
LFFKINVVNNVSLLYGVHTWHWYVSQGIPFIFTTFLPLIGFGLYRIYTTPMFNRIKSLLY
LSMWVVTIYSLLPHKEFRFIYPIVPLILMIAAYGLQQVGSSRWRKRIMLFLVATQIPMAL
YTSIWHQRGVMDVMLWIRSLPANTTTVGVLMPCHSTPWYSVVHDPIPMWFLTCEPPLTPD
TNVLDEADQFYANPTAFLASHQQDRIWPTTHLLLFDNLVPDIRDYLDDQGYRECRRFFNS
HFHDDRRRRGDVVVFC

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	1	403	2.4e-102	0.9974293059125964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	9.18e-112	1	495	41	541	mannosyltransferase
281842	Glyco_transf_22	3.11e-80	1	403	2	414	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14337.1|GT22	3.27e-152	57	496	1	434
AED92081.1|GT22	6.91e-114	1	495	41	541
AHL38632.1|GT22	6.91e-114	1	495	41	541
AAM52236.1|GT22	6.91e-114	1	495	41	541
AAK91470.1|GT22	6.91e-114	1	495	41	541

PDB Hits     

QYA_127973T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94A15|APTG1_ARATH	1.23e-114	1	495	41	541	Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
sp|Q1LZA0|PIGB_BOVIN	4.86e-109	1	486	55	522	GPI mannosyltransferase 3 OS=Bos taurus OX=9913 GN=PIGB PE=2 SV=1
sp|Q92521|PIGB_HUMAN	1.56e-107	9	486	71	532	GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
sp|Q9JJQ0|PIGB_MOUSE	1.74e-106	9	486	60	521	GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
sp|Q6CAB8|GPI10_YARLI	2.15e-105	1	495	18	508	GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.988997	0.010988

TMHMM  Annotations     

Start	End
103	125
135	152
165	187
202	219
235	257
262	284
297	314
318	335
347	365