CAZyme Information: QYA_127793T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_127793T0-p1
• CAZy Family: GH125
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A168HU83]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		50453.02	9.1334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC08:679973-681630(-)

Full Sequence      

VLSSLSLYLRIMKLGFPAYITDIEIETTKQVNWYMAGKFFIGKFPPLAGLVSTGLARLAG
YYGTEELAYPGQPFVEFPIVALRRFSALLGASLVPLTYITMRTMGHSRAAATLASALLIF
ENGIVTQSRYATPEIYVLFFGALATCSWALMNKHTQESHGKLTAQAGFWQIMSGISIGCA
ISAKWTGVLMIPVIWVSILHDSWNKLCERHNSIKSIVKGLVTNVLSTMLLPLCVYLAIFQ
LHFNLIPNAGDHDLLVSSHLKYSLQGNSLEPSQPSKYIAYGSQIVIRHDGTVGGYLHSHR
KRFTGGSTQQEVTLYPHVDINNIWTVHKNNQIWNSSQPVEFVRNMDQIRLEHFASTRKLH
SHDHRPQMTNKKEHNEVTAYGDRLIQDSHDFWTLRVLGDDGLPDKDKNITWKSLNQKFRL
IHIRGCALISHNSYYSPPNGENHQEVTC

Enzyme Prediction     

EC	2.4.1.109:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	4	243	1.2e-42	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	2.05e-67	5	448	33	464	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.33e-37	5	246	6	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	9.16e-16	290	448	6	172	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	6.85e-07	277	329	3	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
224720	ArnT	1.81e-04	37	210	58	206	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13696.1|GT39	9.53e-128	6	431	53	452
CDS09314.1|GT39	1.00e-81	6	448	121	558
CDS13634.1|GT39	4.02e-78	2	448	47	497
QRV72411.1|GT39	5.98e-75	10	448	79	515
QRW01455.1|GT39	5.98e-75	10	448	79	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.10e-56	9	448	63	498	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.99e-54	1	448	70	511	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQP_A	2.38e-18	274	448	19	192	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]
6P28_A	5.64e-18	273	448	1	175	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQQ_A	8.10e-16	278	448	15	185	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BGQ4|POMT2_MOUSE	1.88e-68	1	448	133	574	Protein O-mannosyl-transferase 2 OS=Mus musculus OX=10090 GN=Pomt2 PE=1 SV=1
sp|Q9UKY4|POMT2_HUMAN	1.84e-67	5	448	67	504	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2
sp|Q9W5D4|POMT2_DROME	5.79e-62	10	448	54	485	Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1
sp|Q29IL2|POMT2_DROPS	1.25e-61	10	448	52	483	Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=tw PE=3 SV=1
sp|F1Q8R9|POMT2_DANRE	2.62e-61	5	448	77	511	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998079	0.001908

TMHMM  Annotations     

Start	End
39	61
81	100
135	152
177	199
219	241