CAZyme Information: QYA_113879T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_113879T0-p1
• CAZy Family: CE4
• CAZyme Description: Alpha-1,3-glucan synthase [Source:UniProtKB/TrEMBL;Acc:A0A168IVB6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	McirCBS277-49_SC07|CGC1	83242.38	7.6960

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC07:2257622-2259909(-)

Full Sequence      

MVPLHSTTIRQRGLLDSSPTTGQSSHLPFQFTTRKWRWWNYVSALVSIIVCVELILLVVS
MILLALAPDPITFRIQQNYPKIPYQPLDTTIPITLAPGSNVYHVTKEFGPATMGGMGTVL
TAMTQAQLRTGKIQPNVVLPFYSFLKKQEQYPIKKTVDLVITFRDDREQPVNVEFKVSEM
QYDFEPIPNFNALPEEDKLAIMAARQTKPKIKVFLIGPGKVEPLRKAFRAGSITQIYSSP
KGLPQEWKDQYFTKAAASFLVWRAAGKHEQSLFAPLTSQQPKVDVVHLHGATNAYVAKFL
SEYESQLGATPPAIIYTMHDYLDELQYTNTLPNVEKFLNAPRHGKDLKQEVQSVLVPYTF
GSSKMFMSPMAVDIADTVTFVSQTMAKDMVEGKLDFYLKEVVMENILRKAERGQFYGVSN
GVDFGGSVNPFTERKLVEAGLQYPDFARNLINAKLDYADQMADATAATAAKHWSLSAFHA
DYVTNAKQRAKQFLVDQGVLNAADADRPLVLYVGRFQYNKGLETFENAARLFRLHGMKFA
IIGQPNNYPLSWVKQLAADDPDNIVLMTHTSEQRKWLIYFRAAADFVYVPSVTESFGLVA
AEGLLFGASVISTGTGGLAEFLVDRQLDNEAPAEIVSEQLVESHYRFNAYLFDALATTGD
KRLSQAVMRAAADYKHMRGVPALHETYVLRMMLSAYSLGWERAGSEQGPVYDYLRIYQQA
IYDKRSKSSFALAGDDLDERR

Enzyme Prediction     

EC	2.4.1.21:40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	100	674	6.1e-42	0.9279661016949152

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340822	GT5_Glycogen_synthase_DULL1-like	1.65e-24	100	719	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
340831	GT4_PimA-like	2.89e-14	504	636	189	324	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223374	GlgA	4.95e-14	100	721	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
404563	Glyco_trans_1_4	7.08e-14	507	622	1	112	Glycosyl transferases group 1.
340816	Glycosyltransferase_GTB-type	4.73e-13	511	625	114	229	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06183.1|GT0	1.68e-199	34	741	88	819
CDS14426.1|GT0	3.87e-172	28	721	57	720
CDR38054.1|GT0	1.40e-105	37	727	76	811
CCO66643.1|GT5	2.06e-17	101	714	219	715
APJ04654.1|GT5	3.43e-13	100	623	190	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFW_A	4.72e-07	476	624	9	156	Structure of the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
6FJ3_A	1.85e-06	469	624	321	475	High resolution crystal structure of parathyroid hormone 1 receptor in complex with a peptide agonist. [Homo sapiens]
3L01_A	1.94e-06	476	624	224	371	Chain A, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
3FRO_A	1.98e-06	476	624	224	371	Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]
2BIS_A	1.98e-06	476	624	225	372	Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3M9U1|GLGA1_TRIV2	9.49e-11	491	715	285	489	Glycogen synthase 1 OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=glgA1 PE=3 SV=1
sp|Q8Z0Q9|GLGA2_NOSS1	1.25e-10	491	715	285	489	Probable glycogen synthase 2 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=glgA2 PE=3 SV=1
sp|Q2JSZ9|GLGA1_SYNJA	8.82e-10	487	715	281	489	Glycogen synthase 1 OS=Synechococcus sp. (strain JA-3-3Ab) OX=321327 GN=glgA1 PE=3 SV=1
sp|Q2JNM6|GLGA1_SYNJB	1.54e-09	487	715	281	489	Glycogen synthase 1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) OX=321332 GN=glgA1 PE=3 SV=1
sp|B1MHQ0|MSHA_MYCA9	1.80e-09	505	675	236	418	D-inositol 3-phosphate glycosyltransferase OS=Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) OX=561007 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000044

TMHMM  Annotations     

Start	End
42	64