CAZyme Information: QYA_112879T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_112879T0-p1
• CAZy Family: CE20
• CAZyme Description: Carbohydrate esterase family 16 protein [Source:UniProtKB/TrEMBL;Acc:A0A168JP90]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		30779.94	6.2570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC06:2430398-2431567(+)

Full Sequence      

MDSLTYACRNCTSAGGPNWVIYLTDSTQWISWDFAYNSAPVNNSIVNQVPTVIDVSTQVR
NLYQQIFVSPTKKIAGIVDSVYNKRGIQHTHESTLVTIWVGINDIDLTYNWNSTDQLDLL
IMHRYQILINELIEKGEKNFMLINVPPIHRAPMWHNTENEKLIETRVIEYNKKLEAMVKH
LKSAHASAITFIEYDAWQYFDKLLDDPKEHGITDVLTFCPDWSHPVENHCKPIGEYFWLN
DLHPTFHVHDLLSQDIKRHLQRYA

Enzyme Prediction     

No EC number prediction in QYA_112879T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	8	256	7.6e-46	0.8801498127340824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.17e-39	10	254	32	265	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.60e-11	34	219	80	265	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	0.002	2	254	9	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	0.005	95	225	81	212	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC91480.1|CE16	1.40e-33	12	260	68	315
ATZ57303.1|CE0	4.83e-31	12	261	83	337
QRV72454.1|CE16	1.30e-30	12	253	56	297
QRW01498.1|CE16	1.30e-30	12	253	56	297
QMW25447.1|CE16	4.32e-30	12	261	66	293

PDB Hits     

QYA_112879T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	2.43e-19	12	256	68	293	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.43e-19	12	256	68	293	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|Q99289|HLT_VIBPA	3.65e-10	82	254	227	404	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999357	0.000666

TMHMM  Annotations     

There is no transmembrane helices in QYA_112879T0-p1.