CAZyme Information: QYA_112467T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_112467T0-p1
• CAZy Family: CE16
• CAZyme Description: Alpha-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A162QDD5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749		84647.05	5.4581

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC06:1186067-1188510(+)

Full Sequence      

MTYLALSVADAIKGEFRIGATYYLVVHKAYITIHGRDNKVLFQFLPDLPFIQSSYGQDQI
IAGDGGVFKITETEDGPSNTTVAQTVDTVVTSNNDTGLQLTGTLTFADDRSVGYSFHLQE
LSSKQLDFSIQLDIAQDNNKDHHRILFSFESNANEDFYGFGEQFSYSTLKGQKVPIFVRE
QGIGRGEEPVTSILNDPSGVFGDFAGGDSFTTYCSVPQFLSTDNRGLVLKNSEYASFNLQ
KDDRVTVRLNATLLEGRFFQGNDLLDLVSEYTLYSGRMHRLPDWISDGAVVGIQGGTEKV
RKIIQQLQHYKTPIAAVWLQDWCGKRLQKTPNGVEFKRLWWNWESDDTLYPDWSTFVNDE
LKSQNIRVLSYVNTFLANVEKKQSYRNNYFLEAESHGYLVKDPSSKSKHQTLIISSGTDF
EAGILDLTNPDAVIWFKSIVKQHIYDAGVSGMMTDFGEYLPYHSDKVSLHSGISSEVYHN
RYPQEWAKLHSELVHEIGLENEAVCFYRAGYTRTPGYINLMWAGDQNVAWDEHDGIKSAV
TGMLSGGFSGFSITHSDIGGYTTISAAPLLELVRSKELLFRWMELSAFTAVFRTHEGIIP
ELNAQFYDDQESLAYFAYCAKLYASLSPYRKKLIQEAHAKGWPLMRHLVFYYPHDPIVRQ
ISYSQYLLGDSLLVAPMLTPSVSHVKVYLPKEEGVTWRHVWSNQSFTPTGQDIHVASPFQ
RPAVFIKEPRQDGGLLDEFIAFTAQQDSV

Enzyme Prediction     

No EC number prediction in QYA_112467T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	258	728	9.2e-83	0.9836065573770492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	0.0	128	728	55	619	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	0.0	276	620	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	7.79e-89	56	728	53	666	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.69e-56	258	728	2	438	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	8.43e-49	342	691	49	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13477.1|GH31	1.15e-243	31	742	49	757
UJO15759.1|GH31	5.72e-183	35	747	49	761
USW53386.1|GH31	9.08e-182	45	726	61	741
CAK39259.1|GH31	5.73e-180	31	747	42	762
BCS07610.1|GH31	1.61e-179	31	747	42	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	2.21e-117	136	727	108	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	1.20e-116	136	727	108	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
6PNR_A	2.94e-114	144	738	101	660	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	3.97e-108	153	727	108	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	2.15e-107	153	727	108	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	9.13e-117	136	727	108	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|P31434|XYLS_ECOLI	1.77e-31	135	703	140	641	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|B3PEE6|OL4AG_CELJU	5.59e-29	144	727	141	667	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	3.06e-21	155	728	147	670	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|D2PPM7|AIMA_KRIFD	2.86e-18	143	710	152	695	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_112467T0-p1.