CAZyme Information: QYA_112156T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_112156T0-p1
• CAZy Family: CE16
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A168J4Q6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
762	McirCBS277-49_SC06|CGC12	86920.88	9.7570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC06:259882-262691(+)

Full Sequence      

MGNKQNELKKRKATTVVPNKEPSHTQEINEDIDAIKKQLRYQGGANSDTKHKIASTSVTI
MSFFTTFYMIWFPAQVVFDEVHFGKFAGYYLQRTFFFDVHPPLAKLMLAGVGYLSGFDGV
YQFANIGESYAANNVPYIALRALPASLNVCGVALIYNILKESGFSVLACFTTATLYLLDN
AFIGQNRLILLDSILIFYMLTTIYSYVKFRKYRHQPFTLSWWTWLVATGTSMALTLSVKM
IGLFVVAAVGLAVVMDLWDLLDKKKYGLTNKTLIQHFGARVAGLILVPALVYLFWFYIHF
AILKFSGPGDAYMSTRFQDTLANNPLRINSLDIMYNQSIKLQHKETRAFLHSHMLTYPAR
YEDGRYSSQGTQVTGNMQPDINSYWRIKPTGPIDETLAAKRPVKHNDIIQLEHIGTGLDL
LTHDVASPWMPTNQEFTTTKLAARYNETLFRVQLDDHKVNQVWSTLMQSVKLIHVRTGVA
LWCNNRNLPDWGLNHMEINGNKKSGEERNYWVATDILGLNATDINLKKQEKRAVKQMGFL
SKFLELQIKMITHNNKLTGSHPYQSSPSIWPLMLRGISYWTKDDTQSQIYLTGNVAGWWT
ALVAIGLFSCVSILDMALKKREILILSATSRIRLNRSGGFFLLLWATHYFPFYLMGRSLY
LHHYLPAMACSYLLLGAVFEYLFIDGVNSPVSYQPADKKYTINRARTTIKSYLAAFVLIS
MQFMVYLFLSPLTYGTPGMSAEEAMRHKVLNSWDIQYAKHFT

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	58	300	1.2e-62	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	7.50e-175	49	759	21	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.72e-72	57	303	2	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	3.80e-66	541	742	1	190	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	8.35e-08	349	493	11	163	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	7.58e-05	335	389	6	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13311.1|GT39	8.90e-295	50	759	47	759
VBB72720.1|GT39	1.26e-228	31	759	29	772
CDP23606.1|GT39	1.30e-228	31	759	30	773
CAP69590.1|GT39	1.30e-228	31	759	30	773
QPC75087.1|GT39	2.36e-228	18	759	18	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	7.49e-90	50	762	48	736	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.70e-87	5	680	20	694	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	7.48e-190	20	759	37	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	8.09e-188	48	745	49	749	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	7.33e-184	50	751	46	748	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|F1QF89|POMT1_DANRE	1.51e-110	57	759	20	719	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	6.21e-109	57	760	43	747	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999691	0.000318

TMHMM  Annotations     

Start	End
56	78
137	159
164	183
188	207
219	236
240	261
281	303
596	618
639	661
671	693
713	735