CAZyme Information: QYA_111971T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_111971T0-p1
• CAZy Family: CE16
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A168KN97]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		34590.75	4.8130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC05:2948472-2949587(+)

Full Sequence      

MVLTRSLFLLVFIAAVLAQDVEDPQPDATQSELDDQAIVSSVMYAPVPTNRIAVNRHQLP
PPEYIATSGEQKTVCKNYRTDFSKDTTGWQVENTMQDTYDITGNGLKFHLLSPSKYIRLH
DQNFLPYNEIGGRGPTLNATSYMRYGKVSATMRSAGTGGAVTAFIMMADGGDEIDFEFLG
GDKDQVQSNYFWGQSKEYNVNGGTHKVDGGSIDTTFHKYSIDWKPDRIEWLVDDKVVRVR
IKSETCDASGVCKFPSQPARVQFGLWDGSIESGTAEWSKGPLDWSKPQIIQAFIKSVQVE
CNPEYNQIVN

Enzyme Prediction     

No EC number prediction in QYA_111971T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	133	283	3.8e-46	0.8735632183908046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	5.40e-57	134	301	36	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	8.07e-42	134	279	22	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	1.84e-22	144	291	66	205	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	4.53e-19	145	277	68	191	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	6.34e-19	140	286	44	188	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13191.1|GH16	4.41e-108	66	309	20	264
CDS10243.1|GH16	8.88e-79	75	310	33	274
CDS12756.1|GH16	8.32e-47	132	310	2	145
QDS70497.1|CBM18|GH16_19	8.11e-36	93	301	78	294
QRW05466.1|CBM18|GH16_19	1.44e-35	134	303	130	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	1.62e-28	132	303	57	226	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	3.77e-13	172	273	88	179	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
5DZE_A	2.43e-12	172	273	87	178	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]
5DZF_A	2.47e-12	172	273	88	179	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera],5DZF_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera]
5DZG_A	2.51e-12	172	273	89	180	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera],5DZG_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	1.01e-31	114	301	105	300	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AJC0|UTR2_CANAL	3.07e-28	134	289	129	285	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q8J0P4|CRF1_ASPFU	1.19e-26	132	303	78	247	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|Q05790|CRR1_YEAST	1.19e-26	134	291	178	338	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|P32623|CRH2_YEAST	1.67e-25	134	301	127	300	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999767	CS pos: 18-19. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in QYA_111971T0-p1.