CAZyme Information: QYA_108819T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_108819T0-p1
• CAZy Family: AA6
• CAZyme Description: Glycoside hydrolase family 8 protein [Source:UniProtKB/TrEMBL;Acc:A0A162MSN1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	McirCBS277-49_SC03|CGC14	41063.21	5.0609

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC03:2718716-2719962(-)

Full Sequence      

MGRSVEEAYSKWRSKYLRAYGDGFYVYYKEPSEGCPEMTCSEAHGYGMLIAVLKRNQQDF
DGLYRYFLQWRNQKGLMQWQQKSTKSGSFVPGDQGGQNCATDGDVDVATALFIAGKVWGR
GGTQGEYDYHAAGCALAASIWQHCFNHDTFMPLVGDWADPGDEAYALTRPSDFILSGYLM
FYYCDQERQQIWGNVINAIINTCQAQLALNPQTGLIADFLTLDPRTKTYNPVHKEVLESK
HDPDYNWNSCRVPWRLGHYYMLSKDERLLPLLQTEGQFFANQLAKGGDECPIRAGYKLNG
KCIADYSDLAFSAPVSFLFWVLGWQQQLHQLMRYIDEDDECTYFGESIAMLGFLQAHVPY

Enzyme Prediction     

No EC number prediction in QYA_108819T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	7	354	9.5e-60	0.9875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396020	Glyco_hydro_8	7.37e-14	4	223	3	204	Glycosyl hydrolases family 8.
225940	BcsZ	8.49e-10	38	261	52	256	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11283.1|GH8	7.31e-200	4	360	3	363
AXA50804.1|GH8	4.03e-88	5	351	1	347
AYO43757.1|GH8	3.22e-84	17	351	1	335
SHO79065.1|GH8	1.45e-78	5	351	1	342
SAM75117.1|GH8	1.55e-77	5	356	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	2.52e-45	1	314	58	359	Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1CEM_A	8.67e-30	5	354	27	350	Chain A, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	8.67e-30	5	354	27	350	Chain A, Endoglucanase A [Acetivibrio thermocellus]
1V5C_A	4.01e-27	1	314	27	335	The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	4.57e-27	1	314	33	341	Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19254|GUB_NIACI	1.81e-44	1	314	58	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
sp|A3DC29|GUNA_ACET2	7.52e-29	5	354	59	382	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
sp|P29019|GUN_BACSZ	3.54e-26	1	314	83	391	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
sp|P37701|GUN2_RUMJO	2.44e-18	5	354	63	383	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_108819T0-p1.