CAZyme Information: QYA_107469T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_107469T0-p1
• CAZy Family: AA5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		60440.07	5.4013

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC02:3703182-3704856(-)

Full Sequence      

MSAKEISFRDDNIQYFGRWHTLTNEIQSGWPGAYFRVRLEHTTSVQLQLSKPTSIQVQID
KGPQLDFINTTHISIQQGLEQEGPHELKVIATEIDPTQLSVCLQAILLDETGITLPPAPS
AETPLVEFVGHDLTLGLQTSQTLFSSYAWLTSDLLGLEHSHIAYKRATLIDGMESKYFDW
SVLHDQEQQQQTTRTPWSVVILLGSNDHQTDYASDEYRDALNTFLTKLRKTLYENAPIFI
LSEPLGDMFRPSQQSVLDMTHQGDQYIYFIDTTGWLRYGSNYYRDRGHLTDAGHELLAKK
LAPLLQVKLTHPRDPLPGPPPNPNLPGDWQTMDVGQENRIGLPGTVSADSASTFTLWGSG
ADIDNDTDAFRFVYQPFTNQGTIESTVRSHSAFAKCAKAGIMIREHLGHGSPLIMLGISP
AEGIFVQIRYGNLESTKLIKKMRASPPYRLRLVRQKQNNMFEAQIQHVDGGGSDANWETF
VSVPFVMARDVYAGIAVTSCDTSVVSVAKFTEVALYHSASSLKEQQPMTLQFIDQQQFE

Enzyme Prediction     

No EC number prediction in QYA_107469T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	141	303	1.1e-18	0.8516746411483254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	1.79e-13	126	295	2	158	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	1.95e-05	199	295	65	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	0.002	199	295	69	178	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238863	SGNH_hydrolase_peri1	0.005	199	244	60	105	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATB28301.1|CBM42|CBM66|CE0	5.23e-34	10	303	42	342
ATB41364.1|CBM42|CBM66|CE0	3.21e-33	10	359	43	396
ACU62289.1|CBM13|CE2	4.64e-32	7	305	48	351
QEV23757.1|CE2	1.23e-31	2	365	37	409
AXE84186.1|CE2	9.86e-31	2	365	37	409

PDB Hits     

QYA_107469T0-p1 has no PDB hit.

Swiss-Prot Hits     

QYA_107469T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_107469T0-p1.