CAZyme Information: QYA_106481T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_106481T0-p1
• CAZy Family: AA3
• CAZyme Description: Glyco_transf_64 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A162TNU0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	McirCBS277-49_SC02|CGC16	66964.19	6.5834

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC02:757915-760085(-)

Full Sequence      

MNRRFYILTLISLLCCLLIFTLYPSLRQSSGAFASSSHTSRDERNSVFKIFDKKGALATM
LCDPNMMEATLVSIYSLNSAFAKKPSSKTDVIVLIPESIRFEQQDIHRLEKLGAHVIRTA
FPQSISHQGNDACNTIINLWALFDYQKIVYFTPDVVFDNNVDQLFNYLPGSALSLNDDQD
TPLFVLEPNPHSFENLVRNFRKASSSNYSFPELLQDSYFEYKSRIPPKEIANNLHVYSAP
MKPWNFHAYSDIDWKKHYDPVSFYKWRRISNDVRHLLDPSATKDWVNEPRQRMVCDSYLE
SVTNVNHFPIHDKFSVMISTYNPERIEHLSLIIRHLLQSDQVHTVFITWHNPALQVPSSL
YQDISEKDYERVKVLGQTFDSLNNRFNPVDELKTDAVYIMDDDIYVDLDDLEFTFSVWRS
RKDSVVGHFPRLHTYDPITKDATYKLIGKAPYSIILTKSMFIRSDYLFSYTCLLEPKLHQ
LVDNQLNCEDLGFSMMASGMSHAASTFVRPKKAMEDFGLKQGISTNTAHMPARADCISDF
ITLFWDSKDPLVNSYDIAAPFAKPQIRVGNWDRIEKTILG

Enzyme Prediction     

No EC number prediction in QYA_106481T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT64	314	554	4.3e-52	0.9596774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401264	Glyco_transf_64	2.06e-35	314	555	1	236	Glycosyl transferase family 64 domain. Members of this family catalyze the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.
133018	GT8_Glycogenin	6.67e-12	56	267	2	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12929.1|GT64	1.69e-119	136	578	47	452
BAM79674.1|GT64|GT8	7.92e-61	53	563	156	722
NP_565236.1|GT64	3.64e-29	312	555	46	304
AAG52433.1|GT64	3.64e-29	312	555	46	304
ABD59059.1|GT64	3.64e-29	312	555	46	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AU2_A	8.09e-24	312	544	632	858	Chain A, Exostosin-like 3 [Homo sapiens],7AU2_B Chain B, Exostosin-like 3 [Homo sapiens],7AUA_A Chain A, Exostosin-like 3 [Homo sapiens],7AUA_B Chain B, Exostosin-like 3 [Homo sapiens]
1OMX_A	4.28e-19	312	544	28	267	Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) [Mus musculus],1OMX_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) [Mus musculus],1OMZ_A crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) in complex with UDPGalNAc [Mus musculus],1OMZ_B crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) in complex with UDPGalNAc [Mus musculus],1ON6_A Crystal structure of mouse alpha-1,4-N-acetylhexosaminotransferase (EXTL2) in complex with UDPGlcNAc [Mus musculus],1ON6_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminotransferase (EXTL2) in complex with UDPGlcNAc [Mus musculus],1ON8_A Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) with UDP and GlcUAb(1-3)Galb(1-O)-naphthalenelmethanol an acceptor substrate analog [Mus musculus],1ON8_B Crystal structure of mouse alpha-1,4-N-acetylhexosaminyltransferase (EXTL2) with UDP and GlcUAb(1-3)Galb(1-O)-naphthalenelmethanol an acceptor substrate analog [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C975|GT643_ARATH	6.47e-30	312	555	46	304	Glycosyltransferase family protein 64 C3 OS=Arabidopsis thaliana OX=3702 GN=At1g80290 PE=2 SV=1
sp|P70428|EXT2_MOUSE	3.35e-23	268	544	412	684	Exostosin-2 OS=Mus musculus OX=10090 GN=Ext2 PE=1 SV=2
sp|Q9WVL6|EXTL3_MOUSE	4.27e-23	312	544	660	886	Exostosin-like 3 OS=Mus musculus OX=10090 GN=Extl3 PE=1 SV=2
sp|O43909|EXTL3_HUMAN	4.27e-23	312	544	661	887	Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
sp|O77783|EXT2_BOVIN	4.45e-23	268	544	412	684	Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.895248	0.104761

TMHMM  Annotations     

Start	End
5	24