CAZyme Information: QVM12485.1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: QVM12485.1
• CAZy Family: GT48
• CAZyme Description: N-acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		40472.25	6.3586

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira2022	8438	N/A	139	8299

• Gene Location: location=CP075071:645145-646346(+)

Full Sequence      

MDADTRPYNFTWRAIVGSKRARVVLLLLTLILCVSLLLPYAPSRSLPHFPKLPKPEDPPP
KNDDQVDWSQFAYSQYATNPDYLCNSVMIFTTLKRLGVKADRILLYPQEWPDNDPADPKS
GLLIKARDELGVKLRPISVLQESADPTWGASFTKLLAFNQTDYRRVLNIDSDSTIFQSMD
ELFLFPSAKVALTRAYWLDNFLSSQLILLEPSATEFARIQESIKNKKPNDFDMEIVNYLY
KDHCMILPHRPYNLLTGEFRGDKHAAYLGSEEEVFDPEKILKETKLVHFSDWPYPKPWIN
ASKRETERLMPECKTSEQGGEQDCRNQKTWLWLYSDFKERRKNVCGSDF

Enzyme Prediction     

No EC number prediction in QVM12485.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	73	299	1.4e-19	0.867704280155642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	2.33e-81	71	337	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	3.50e-23	71	298	1	212	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	3.28e-10	69	186	69	191	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	3.29e-07	72	298	2	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12485.1|GT8	5.98e-266	1	349	1	349
QSS69037.1|GT8	4.62e-127	52	346	54	352
QSS51045.1|GT8	9.29e-127	62	346	65	352
QSS63276.1|GT8	2.86e-111	52	319	54	326
QKD51705.1|GT8	2.79e-109	65	346	40	325

PDB Hits     

QVM12485.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	3.49e-97	66	347	150	436	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	1.31e-86	64	345	73	373	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q59ZI3|GNT1_CANAL	2.53e-28	70	341	70	456	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q12096|GNT1_YEAST	2.33e-25	61	345	82	489	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q6BUZ2|GNT1_DEBHA	1.08e-23	66	298	63	399	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000004

TMHMM  Annotations     

Start	End
21	43