CAZyme Information: QVM06522.1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: QVM06522.1
• CAZy Family: CE4
• CAZyme Description: threalose-6-phosphate phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731		84043.49	7.1874

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira2022	8438	N/A	139	8299

• Gene Location: location=CP075068:4472045-4474315(+)

Full Sequence      

MTSLSKASAPIPVDGSHKPQPPADGIHVRKEDRDRLEKQLHSSKYGMILPVWLSDDCESP
EETLHLKDQTRWRRYAEREIYPLFHYKQHGPTDGRAERRWWQDYQRMNQLFADRILEIYR
PGDIVWIHDYHLFLLPSMLRQRIPEIYIGFFLHVPFPSSEFFRCLTRRKEVLTGVLGSNM
IGFQSFTYSRHFSSCCTRILRFDSNSAGIDAYGAHVAVDVFPIGIDVDAVRKMAYGEPNI
EKTIAEIKKLYAGKKIIIGRDRLDSARGVTQKLIAFEMFLERYPEWRDKVVLIQVTSPTS
VEEEKEESEAKLSSQMSHLVSTINGRYGSLSFSPVQHYPQYLSRHEYFALLRAADVGLIT
SVRDGMNTTSLEYVVCQHENHGPLILSEFSGTAGSLHNAIHINPWDSGGVAAAINEALTM
SYEQREEQHEALYKYVTTHTVSIWSDLYIGRLLNNLSSFNQSIATPVLDKAKLLYQYRKA
RRRLFMFDYDGTLTPIVKDPQAAIPSDRVVRTLKSLAADPKNSVWIISGRDQNFLEEWMG
HISELGLSAEHGCFIRKPHNEVWENLTEKSNMGWQKEVLDIFQHYTERTQGSFIERKRVA
LTWHYRRVDPEYGAYQAKECRKHLENTVARKWDVEIMAGKANLEVRPTFVNKGEIASRLV
NECQGRPEFVLCLGDDFTDEDMFRALRHSNLPKDRVFAVTVGASSKQTEASWHLLEPADV
IATISLLNSCN

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	63	451	1.8e-155	0.7936842105263158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	25	452	50	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	30	720	58	716	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	2.46e-180	50	448	77	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	1.31e-163	25	683	143	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	1.12e-160	28	452	68	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67563.1|GT20	0.0	2	729	186	918
QQK47779.1|GT20	0.0	4	729	206	937
CAP86177.1|GT20	0.0	4	729	206	937
QMW46130.1|GT20	0.0	4	729	210	939
QRD94182.1|GT20	0.0	4	729	143	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	1.81e-155	463	729	1	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	4.79e-150	465	729	3	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	1.15e-140	24	455	110	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	3.35e-98	465	727	5	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HVM_A	5.03e-94	25	458	62	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	2.52e-221	27	727	113	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	1.91e-217	49	721	135	806	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	7.80e-204	24	727	108	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	2.16e-171	72	724	139	783	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14145|TPS2_SCHPO	4.24e-168	75	720	172	842	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QVM06522.1.