CAZyme Information: QVM05792.1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: QVM05792.1
• CAZy Family: AA3
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:E9DFI5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720		78903.64	6.6953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira2022	8438	N/A	139	8299

• Gene Location: location=CP075068:1753505-1755909(+)

Full Sequence      

MASQNVFLPVSKDQIPANIPKRDGHPVRKDHITDAPGPISTNKFYANFFLGNQSDYSFIQ
PYSVGWSKGANPTGSFGLAISHSDANQTVFGERSDVIPGNPVRFYANPVGIQSIILSAEE
LKNSTTLSLSNPQAFSANVILRPQKDSDASASFPLVQGMGFVTGLYDNLQPVIQSQVSFK
QVDAAGSPKDGIFKYKASLQDGASWLLYVTPENGADPKLVLVSNNTIRGSKGFNGFIQVA
KDPGNGDSIYDGSAGVYPTAANIAGSVTGNQGTYQFSWTKAGKNANNTPLLMFALPHHVE
AFDDSSKRRKTDLKLQTTTKGQATACVGDSWTMIEPNLPVDIGFEPWKPGMSGKPSLSAG
AKEQIKAVALSELSQDMESQTNLDSMYFSGKALGKFAGAVYTAQELLQDAGLASRALESL
KKSFARFVENKQKHPLVYDTVWKGAVSSGTYQTGDIYLDFGNTLYNDHHFHYGYFILTAA
IIGHLDRSWLDTNKVWVNMLVRDASNSVSDELFPFSRGFDWFNGHSWAKGLFASIDGKDQ
ESTSEDTMFAYALKMWGKTSGDASMEARGNLMLGILYRSLDSYFLMRRSNVNQPKEFIDN
KVTGILFENKCDHATYFGANLEYIQGIHMLPLLPASAYTRRSEFVREEWNAMFAPNATKP
ADTVEGGWRGVLYANLAIIDAEASWKFFTQPNFNMGWIDGGASRTWYLAYAACLGGGPKY

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	29	710	4e-232	0.9839228295819936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	356	708	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	25	718	75	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.21e-166	25	349	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABH10633.1|GH81	0.0	1	720	1	720
BCS18746.1|GH81	0.0	2	717	169	885
CBF89420.1|GH81|3.2.1.39	6.30e-318	1	717	187	904
CAP93568.1|GH81	6.39e-318	1	712	177	889
AAF13033.2|GH81|3.2.1.39	7.86e-318	4	712	16	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.19e-106	5	712	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.14e-106	5	712	32	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.94e-103	5	712	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.49e-24	370	690	324	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5T49_A	1.52e-20	463	638	458	633	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	1	712	188	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.61e-178	5	718	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.49e-165	3	714	72	778	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.09e-163	38	712	460	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.27e-161	5	714	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000041

TMHMM  Annotations     

There is no transmembrane helices in QVM05792.1.