CAZyme Information: QSL66656.1

Basic Information

• Species: Pneumocystis wakefieldiae
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis wakefieldiae
• CAZyme ID: QSL66656.1
• CAZy Family: GT57|GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	CP054544|CGC2	37284.18	8.4187

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pwakefieldiae2A	3223	N/A	41	3182

• Gene Location: location=CP054544:195205-196223(-)

Full Sequence      

MKQWALITLICGLFFLAFLFNKSWFLIRLLFENFELERISQGTILYSDSHYIDPKKQVIP
RIIHQTWKNETIPEKWEQAYSSCKKNHPNYEYIFWTDEKARNFIAQEYSWFLDQYDKYPY
NIQRVDSFRYFALVHYGGIYIDLDVECLKPLDPLLSYGAWLRMTDPTGISNDVMGSVPYH
PFFIYVVNRLKSSSGNWIFPYLTVMATTGPLFLSVMLEKYMFFLSSDAFTSEHVRIIAPD
ISNKIFKNFHGSTWHQKDAWFFFWLQRYWLFLFIASIGITCFYSLRLFRRKLYKNFNCMR
WICFSDGELP

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	155	6.5e-27	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.09e-62	48	271	71	297	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.77e-26	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL66656.1|GT32	4.05e-242	1	310	1	310
BCR89010.1|GT32	4.00e-93	1	280	1	281
EAL85572.1|GT32|2.4.1.-	8.59e-92	1	272	1	273
BCS17906.1|GT32	4.89e-91	1	280	1	281
QMW44769.1|GT32	5.20e-91	1	276	1	277

PDB Hits     

QSL66656.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	8.07e-76	29	277	29	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.65e-75	58	292	81	319	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	1.81e-70	48	303	51	300	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.38e-69	54	259	50	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.83e-59	47	291	52	302	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995013	0.005022

TMHMM  Annotations     

Start	End
4	26
195	217
263	285