CAZyme Information: QSL65680.1

Basic Information

• Species: Pneumocystis wakefieldiae
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis wakefieldiae
• CAZyme ID: QSL65680.1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	CP054538|CGC1	77737.43	5.1973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pwakefieldiae2A	3223	N/A	41	3182

• Gene Location: location=CP054538:379512-381689(+)

Full Sequence      

MPYMPPSCGSLNKISASALKCSVDGKIEEEYYEKNTIVWDREWGELPEIWFSTSSKQMKK
DVFDTDKEDGGKERQEKQETIKNMIESMPEYVSDTLRVDNSYKYASEEEWRRKEWQSWKI
SEERQELQRLSSYLRKVSSSPSFESTLSAYENAAKELSQSANSEPTEKIDALEDFNGLKV
VRKKSGELVKSSLKSEKHKRPQSMPSTPILHKNVQFATKLEEIKHFSQAEKPEEVSKSGL
IDESYQDIYGMAFDYDLYDLKKEEKNSDLTIELVNFENRETLCLFQNVQLETVYLSSDKR
HLLGRVAVKNLSFEKIVGIRFTMDFWQTISEVNAEYTDDILTKQYKDNLDRFVFNIKLHE
LMNIENKTLYLCVRYRIPGEEFWDNNSGMNYKIGFKRKSKMHTRPFIHFPPFSLGSRYLN
DDFDEESDYHLSTFQSYKNDPIHVSQMNDSTNTKQLSRKKDNFANNFSNRYDFSTSLTAA
IKASGTTNYSENKSKDSKTKDIDSYEDSIKNVDLYFSDLFLVEKPLTKSRSNTSFGNDIS
NTLSLSDINLSTSSQENGIECDLFKGIIVLGSDKINTQDAEPTAHTDENSEKSISSISHK
KSNSSNSLPSISEFIPFSSFSRPSLFYSQSSISSVDSVSNVQQPSESKSSINLYYNHLIN
SSLTLETPGGTLTAIRT

Enzyme Prediction     

No EC number prediction in QSL65680.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	286	393	7.1e-33	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	5.06e-42	286	393	5	112	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	6.15e-07	310	393	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65680.1|CBM21	0.0	1	677	1	677
EGX51847.1|CBM21	9.44e-54	158	487	217	565
UDD62044.1|CBM21	1.23e-52	180	482	219	539
ACP93043.1|CBM21	4.81e-52	180	432	57	317
QMW42372.1|CBM21	8.12e-52	180	482	219	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2M83_A	7.46e-12	284	398	23	138	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0VCR4|PPR3C_BOVIN	4.21e-13	248	393	109	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
sp|Q7TMB3|PPR3C_MOUSE	2.42e-12	296	393	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q5BL87|PP3BA_XENLA	1.26e-11	272	393	116	228	Protein phosphatase 1 regulatory subunit 3B-A OS=Xenopus laevis OX=8355 GN=ppp1r3b-a PE=2 SV=1
sp|Q9UQK1|PPR3C_HUMAN	1.40e-11	296	393	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q6GQ68|PP3BB_XENLA	2.04e-11	272	393	114	226	Protein phosphatase 1 regulatory subunit 3B-B OS=Xenopus laevis OX=8355 GN=ppp1r3b-b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QSL65680.1.