CAZyme Information: QSL65479.1

Basic Information

• Species: Pneumocystis wakefieldiae
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis wakefieldiae
• CAZyme ID: QSL65479.1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		100470.28	6.0878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pwakefieldiae2A	3223	N/A	41	3182

• Gene Location: location=CP054537:424464-428693(+)

Full Sequence      

MIFYRKLIFIILLIKEWKIIYTETDTSEWLVKEAEMAENASLFWGPYRPNLYMGIRSRDP
DGMLMGIMWTGVDNYTQIREMRHTCEQNDNIKMYGWEEFDIRKGGRQIIKDDGMNIEIEM
EFAKIYTEKHNGNWGLRIKGKTSNGTILMIASGNNEIKLISKLEKKGVKGDVVFMNKTSK
KKIIEITQGPSTNAHPLFTHEAENEKYLDRFMYHSMKVSKKKMWMAKDLLYSVLILAAKD
YYEKYNENTPPAALYYTLPNIDEEGNFHLVQRVFQGPFEFDILYSSTDDPMTSYQLENEI
ISNSKLFKERFMEIFSFKDPFNSDKYMVFAQNLLSNLLGNIGYFYGDSIVDKTYTYEYQE
ILEEYNSYISPQVQGPFSLFTSTPSRSFFPRGFYWDEGFHLLLIGHWDNDLRHFINNSWF
SLIDEDGWIAREQILGDESRSKVPKEFIIQYSNCANPPTLILPIISFIEKLEQNNRNQTD
QGNKEENIYSKYIKYPQLAINYLKEIYPLISRQYNWYRRTQQGEIERWNRNAFSSDEGYR
WRGCTPQHCFASGLDDYPRAYPHNGELHLDLLSWMGLFTKGLRMIAEKIGYQEDVEKYIS
IEDAIVKNIDDLHWSDEHNAYCDCTIDEKNLSIHECHIGYVTIFPLLTGLLSASSPRFDR
LLDIIYSPDHLWSSYGLRSLSIKSPYYGKDENYWRGPIWININYMALQSLYKNYIHTPGP
YQEKARKIYDELRVNVVNTVFHEWKRTHFAWEQYNQASGAGQRTKGFTGWTSLIKEDSFF
FGKKRTDIDTYMGLFFSKTYMRETCVYLSGMTFSLGWWFFVDSVLYSSVVDAGKIHITLV
DWIPCILSTAGMLM

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	566	774	9.3e-30	0.4245614035087719

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	291	774	1	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.00e-81	42	251	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
398773	UPF0220	1.20e-15	802	854	16	68	Uncharacterized protein family (UPF0220). This family of proteins is functionally uncharacterized.
225942	GDB1	3.45e-07	491	757	350	593	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	0.006	645	772	661	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65479.1|GH63	0.0	1	854	1	854
QRD84190.1|GH63	1.38e-258	30	774	28	797
UDD57712.1|GH63	1.38e-258	30	774	28	797
QMW44709.1|GH63	3.33e-257	30	774	28	809
QMW32679.1|GH63	3.33e-257	30	774	28	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	4.90e-156	31	774	4	796	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	7.24e-116	42	774	37	771	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.23e-221	31	774	31	800	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	6.61e-155	32	774	35	826	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	4.08e-119	42	774	92	826	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	9.43e-117	42	774	94	829	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	2.40e-116	42	774	92	826	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.622079	0.377929

TMHMM  Annotations     

There is no transmembrane helices in QSL65479.1.