CAZyme Information: QSL65449.1

Basic Information

• Species: Pneumocystis wakefieldiae
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis wakefieldiae
• CAZyme ID: QSL65449.1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1009	CP054537|CGC1	116743.51	7.4753

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pwakefieldiae2A	3223	N/A	41	3182

• Gene Location: location=CP054537:356266-360160(+)

Full Sequence      

MPTVNVDKEDLFNSFDYNYTIEEFSELCFNFGLELDEDTYESEAINETLKRPQLKIEVPA
NRSDLLCLEGIASALNIFLGRQKIPQFKLSRPKNLQILKVSKETEKIRPFISAAILRGVC
FTKQRYESFISLQDKLHSNICRNRSLASIGTHDLDTIQSPFSYEAHEPEKINFIPLNQKK
SMNMDELFKLYENDRHLGKFLHLIKDSSVYPVIYDSNRIICSLPPIINSEHSKITLNTKN
VFIEVTATDQTKLEIVTNIMVAMFSCYSEEPFTIEPVQIESPHNHCSRISPNIDHNIKSV
EISYINSCCGLNLSSKEITKLLEKMGLSSKQSIINPELLDVFIPITRPDILHQCDIMEDI
AIAYGYNCLKKTFPNKIITIGKPLPLNKLTDIIRMECSMAGWSEVMSLILSSHDENFKYL
GKTDDSLAVILENPKTAEYQVVRTTLIPGLLKTIRENKKHSLPIKIFEVSDVVLRNDNEE
TFCKNKRLWSAAYFSNTSGFEIIHGLLDRIMSMLSTNKVAPESKDPGYWIECLEDSMFLK
GRCAKVFLRFENMLEVNIGIFGILHPNVLKAFEIPFISRTRKILISPVLTDSYLIGSQVL
AWSLRDSGSKKHLTALVTKKTLSESTLKALEETYDEIINVEPIYSKDIDKLHLLGRPDLR
CSFTKIHVWAQEKFKKIIYIDADAFCLKNIDELFDIDTDFAAVPDVGWPDIFNSGVFITK
PSISVYNSLLSLAKNSISFDGGDQGLLNFYFSNWRRLPFIFNVVPSFSYQYSPAYYHFKS
KISIVHFAGTKKPWTLSKDQINSKPYNELIEKWISIQRSRIRPQGYTDNLSCEEKIHLEK
KKTIESQESEYDINKNSISYELLIQKASLYDRMKFNHKQLEEQDLSSILSKTTFFCNSNC
KNEQNRSFNPDKLLFIPQPPLLIPGYIKEIEEYNRYRNGIEEFNKYKNEILQIEKKHMFP
WARQKMKATRVFMDHDQENKIDMSKYDIRITKKNVFLHYKTKEMSISKF

Enzyme Prediction     

No EC number prediction in QSL65449.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	585	795	1.8e-43	0.8638132295719845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215149	PLN02265	0.0	1	575	1	583	probable phenylalanyl-tRNA synthetase beta chain
273096	pheT_arch	1.21e-161	1	576	1	538	phenylalanyl-tRNA synthetase, beta subunit. Every known example of the phenylalanyl-tRNA synthetase, except the monomeric form of mitochondrial, is an alpha 2 beta 2 heterotetramer. The beta subunits break into two subfamilies that are considerably different in sequence, length, and pattern of gaps. This model represents the subfamily that includes the beta subunit from eukaryotic cytosol, the Archaea, and spirochetes. [Protein synthesis, tRNA aminoacylation]
236592	pheT	1.34e-146	1	574	1	534	phenylalanine--tRNA ligase subunit beta.
223150	PheT	7.83e-107	1	576	1	534	Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis].
133018	GT8_Glycogenin	1.79e-77	588	816	7	236	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65449.1|GT8	0.0	1	1009	1	1009
QKX56620.1|GT8	3.76e-68	588	824	13	250
EGX51624.1|GT8	8.40e-68	588	823	8	246
VCU39522.1|GT8	4.16e-67	588	816	13	247
CAK43246.1|GT8	5.68e-67	588	823	12	248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L4G_B	3.10e-167	1	589	1	589	Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens],3L4G_D Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens],3L4G_F Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens],3L4G_H Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens],3L4G_J Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens],3L4G_L Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens],3L4G_N Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens],3L4G_P Crystal structure of Homo Sapiens cytoplasmic Phenylalanyl-tRNA synthetase [Homo sapiens]
7BY6_B	1.29e-99	2	574	3	598	Chain B, Phenylalanyl-tRNA synthetase beta chain, putative [Plasmodium vivax]
7DPI_B	5.53e-99	1	574	1	603	Chain B, Phenylalanyl-tRNA synthetase beta subunit [Plasmodium falciparum],7DPI_D Chain D, Phenylalanyl-tRNA synthetase beta subunit [Plasmodium falciparum]
3U2T_A	6.69e-52	576	799	20	247	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese [Homo sapiens]
3T7M_A	6.76e-52	578	799	1	226	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7M_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7N_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7N_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7O_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3T7O_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3U2U_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2U_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2V_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2V_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2X_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens],3U2X_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13432|SYFB_CANAX	1.21e-219	1	583	1	586	Phenylalanine--tRNA ligase beta subunit OS=Candida albicans OX=5476 GN=FRS1 PE=2 SV=3
sp|O42849|SYFB_SCHPO	1.59e-213	1	574	1	574	Phenylalanine--tRNA ligase beta subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=frs1 PE=3 SV=1
sp|P15624|SYFB_YEAST	1.13e-197	1	576	1	582	Phenylalanine--tRNA ligase beta subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRS1 PE=1 SV=3
sp|Q9WUA2|SYFB_MOUSE	4.67e-169	1	589	1	589	Phenylalanine--tRNA ligase beta subunit OS=Mus musculus OX=10090 GN=Farsb PE=1 SV=2
sp|Q9SGE9|SYFB_ARATH	1.25e-168	1	575	1	584	Phenylalanine--tRNA ligase beta subunit, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g72550 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QSL65449.1.