CAZyme Information: QSL64400.1

Basic Information

• Species: Pneumocystis wakefieldiae
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis wakefieldiae
• CAZyme ID: QSL64400.1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		58639.96	9.2576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pwakefieldiae2A	3223	N/A	41	3182

• Gene Location: location=CP054533:232717-234626(+)

Full Sequence      

MDHKKSSKKYETQVNIKKESNDIWEPICWMIYVVKWSSFRFLILPVILLFAIIVRALVAL
GTFSGVNSGEKFGDFETQRHWMEITLHLPIKEWYFYDLQWWGLDYPPLSAYLSYIFGKIG
SLIDTSWFALDTSRGLQTQDLKFYMRMTVIISDIIIYFPAVIRFSRYWKRLEKGNALNTY
SSIALILLQPALILIDHGHFQYNNVMLGLALLSLCYFINDRYIFGSIFFIFSICFKQMSL
YYSPLIFFYLLGLCTKPKLNICRFIYISITTISTFTIIFLPFYIYGGYNGILQCIHRIFP
FERGLWEDKVANACSSIATLISIFPLCLIIFLKPKVYLLPWGLTCCAFGFFLFSYQVHEK
SILLPLMPATMLLLIPNKNVKAWIGWINTIATFSMWPLLKKDGLGLQYAALQIYWLWLGG
FMFFPLNKFEKFIHKTSYALLIAIHTLDAFFCPPSRFPHLWILLNMKLIMVKVWYLDEYK
NKAEIDFIYITFIFFKIY

Enzyme Prediction     

EC	2.4.1.267:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	52	312	6.4e-101	0.525987525987526
GT57	314	474	1.1e-32	0.36174636174636177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	5.42e-137	73	466	15	461	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64400.1|GT57	0.0	1	498	1	498
CAA17695.1|GT57	1.03e-145	38	468	22	473
NP_596744.1|GT57	1.03e-145	38	468	22	473
ANB14871.1|GT57	1.35e-145	35	468	231	698
QGN17613.1|GT57	7.32e-144	46	480	74	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	2.70e-133	46	465	59	532	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43053|ALG6_SCHPO	1.84e-146	38	468	22	473	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg6 PE=3 SV=1
sp|Q12001|ALG6_YEAST	7.96e-133	46	465	41	514	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG6 PE=1 SV=1
sp|Q54QG6|ALG6_DICDI	3.26e-90	34	464	8	487	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg6 PE=3 SV=1
sp|Q802T2|ALG6_CHICK	4.46e-87	35	461	3	470	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus OX=9031 GN=ALG6 PE=2 SV=1
sp|Q3T1L5|ALG6_RAT	1.90e-81	44	453	7	436	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Rattus norvegicus OX=10116 GN=Alg6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999941	0.000082

TMHMM  Annotations     

Start	End
41	63
108	130
143	162
177	195
202	224
229	251
264	286
310	332
337	359
404	426