CAZyme Information: QRD93295.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD93295.1
• CAZy Family: PL20
• CAZyme Description: putative heat shock trehalose synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		76756.81	6.5641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044616:3018803-3021130(+)

Full Sequence      

MSEQQQQRKRERDINEGTSWSGRSLTTIYAGISVLHRDYEDSRAAIAFRNSAYLFDYIVF
DLPAESSNTPVHTICNRIVSELRTYSEKHKEKLIGLAMPLLLADKYPPLCPQLWRELDIL
PLVLEHKERARADADQGELATFASWNTKELDEQADSMVRKCLRSFGAGHVLQGEIGLGSL
VGVDRNFRVRLADLQDYQETVNARTWSMAQDYAEELKRRNVKIAFFSLSSHGRPDIHTRH
SLVRFLHYLGVNVQCGLNMWSRYVPKPRPGINSIIRKMQDSLEGLGERDDSITVDEEMCI
LQWVYENARRYWLCEDDPLQARSKGGADIVVIDDVPLTPAALLSKQTDPGRPVIFENRLQ
VQKGALQDASNFSTRPWNFLRERLKHVDLVVSQAPKELLPNIMPQKKVVYIPVSVDQLDG
LNKCMSDFDLTFYGREFNTLCRSFETPTLNYPNEEYILHLSQFRNLDETITVLNAYQKFR
SHCMDAGMNTLFPKLLIYHYGPSRSSRSTLIYDAILSYIETDMPRLKSCIYVMQIGPPDQ
LWNTLLTRAKVVIELSMCEGIPAMLLAAVQKGKPIITAKEIGQFSFTKGVNNILFCEKGD
ADIIARLLRDLWTDPRLSELLLPGSRRLRDEYTTVGNAVNWLFLAAEMSREGNVVEPDGR
SIYELAGQGAGLCA

Enzyme Prediction     

No EC number prediction in QRD93295.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	1.74e-99	222	647	1	377	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
223515	RfaB	1.69e-05	377	633	144	362	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD93295.1|GT4	0.0	1	674	1	674
QMW47856.1|GT4	0.0	1	674	1	667
QMW35794.1|GT4	0.0	1	674	1	667
BAE65846.1|GT4	0.0	1	674	1	669
UDD64944.1|GT4	0.0	1	674	1	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X6Q_A	8.85e-06	194	609	16	378	Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6Q_B Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6R_A Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii],2X6R_B Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O75003|TREPH_GRIFR	5.03e-84	24	665	35	707	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|A6YRN9|TREPH_PLEPU	8.45e-81	24	665	39	714	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|Q9UV63|TREPH_PLESA	5.42e-74	24	665	39	726	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in QRD93295.1.