CAZyme Information: QRD92784.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD92784.1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		38492.58	4.8654

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044616:1544386-1545492(+)

Full Sequence      

MMLVAPRRYVYLGTGFSLVLLFWYTFGSPLAQATGIVSPLEPASVPPPTHSASNATLGFQ
SILALSSGPSWRTRGLMAAANLTGLSIHIPPQPPIHPDLVETFETLGSEYIRHPSHGASI
AWLAHLDLIKYTIQADLDTALILEDDADWDVTIRSQMVRIAESVRNLTGTTESETAPYGR
DWDVLWIGHCAEYWEDLFETVFYEDPTACPHKYYFGFAKENIERMPDHQRAVYWSANPVC
SFAYALSRDGSRKVIELLGAGQDEAFDVSMMHACSAGKLKCISVVPEVVHQYFPNQTFGV
KSMVDIGNGEQAGPDDSEFEHIMGSTENILESARCRALWNKRCLRE

Enzyme Prediction     

No EC number prediction in QRD92784.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	6.19e-04	122	150	68	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92784.1|GT25	1.25e-261	1	346	1	346
QMW36233.1|GT25	4.89e-261	2	346	1	345
QMW48287.1|GT25	8.12e-260	2	346	1	345
BAE66503.1|GT25	8.12e-260	2	346	1	345
UDD65488.1|GT25	8.12e-260	2	346	1	345

PDB Hits     

QRD92784.1 has no PDB hit.

Swiss-Prot Hits     

QRD92784.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.350410	0.649580	CS pos: 33-34. Pr: 0.5957

TMHMM  Annotations     

Start	End
9	31