CAZyme Information: QRD92720.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD92720.1
• CAZy Family: GT15
• CAZyme Description: glycosyl hydrolase family 76-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		50595.68	4.4618

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044616:1390053-1391613(-)

Full Sequence      

MRGLSWQQLGGAVLLLLQGQVALSALSVQVNSKDSLANAGKEIADPMMDFYAQNQTEGIP
GKLTDTWYIAGAMFMTLIQYWATSGVEQYNKVVSHDLMFQSGENYDYFSSNYSQWLGNDD
QMFWGLASITASETGFPEVSGKPTWTSLARTVFNMQVERWDETACNGGLRWQIWPYQAGY
TMKNSISNGGLFELSARLARFTKNETYAEWAEKIWDWSASSPLILTDKWYVADSTSNENN
CKDSGNNQWTYNYGTFLSGAAFMYNYTNGDEKWLKRVNGLLESTFATFFPSTYGGNVLSE
VACEPIMSCDRNQLGFKGYTAMWLAHTAILVPSTAERITPKLQGSAEAIAKQCSGESENL
CGETWGKDTWDGMKGLEVQMAALGGITSNLMLLESKSPQTIDTNPDAAEHHIDNNENSSK
DPTKAKPIETADRAGAWILTVMIAAGAIGAVGWLIKTQ

Enzyme Prediction     

No EC number prediction in QRD92720.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	398	6.1e-100	0.9553072625698324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	35	383	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48345.1|GH76	0.0	1	458	1	458
QRD92720.1|GH76	0.0	1	458	1	458
QMW36289.1|GH76	0.0	1	458	1	458
UDD65548.1|GH76	0.0	1	458	1	458
BAE66452.1|GH76	0.0	1	458	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.22e-82	29	403	29	415	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	3.60e-93	25	392	19	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	3.39e-89	24	455	20	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	7.35e-89	25	455	18	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	9.67e-88	16	455	6	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	5.88e-85	30	440	24	426	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000715	0.999237	CS pos: 24-25. Pr: 0.9688

TMHMM  Annotations     

Start	End
433	455