CAZyme Information: QRD92392.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD92392.1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		38746.59	5.0629

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044616:579207-580760(+)

Full Sequence      

MSGGGTSGIVLAARLSEDDSKSVIIREAGRNLADDFRVQTPALWTTLLGSEADWQLITAP
QTELRNRLHRSLQAEIHAWSKLSAIDWTWEKLSPYYKKSYTLQLPDEATREHIGLSWVDQ
NVNGDSGPINISFPAVLQDPLSKAWVDTFKGIGYSLTADPFSGNSIAGYSNLATVDYKTK
TRSYAATGDAGVTATGVKAILQGELSTIKAKKEVILTAGALNTPKLLELSGIGNKAILDQ
FNIPVVVENPNVDENIQDYLMSRISSEANLHQRGKSFVGQELLPGNFLSLGLELSLPFSR
GSVHIASADPNVPPTIDPRYFSNPLDLDIMARNLLDVETRETSQSGPSSPVSGLWGH

Enzyme Prediction     

No EC number prediction in QRD92392.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	334	1.5e-35	0.3640776699029126

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.49e-45	3	326	12	420	choline dehydrogenase; Validated
225186	BetA	4.68e-38	3	334	14	429	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
215420	PLN02785	4.70e-09	213	327	281	454	Protein HOTHEAD
366272	GMC_oxred_N	3.90e-07	194	237	162	207	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92392.1|AA3_2	2.33e-258	1	357	1	357
UDD65866.1|AA3_2	3.15e-211	3	357	17	341
QMW36565.1|AA3_2	2.93e-188	1	268	1	268
BCS02826.1|AA3_2	8.12e-140	3	338	17	495
BCS14479.1|AA3_2	8.12e-140	3	338	17	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.02e-29	3	321	12	443	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.56e-27	1	258	10	309	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4HA6_A	6.71e-20	3	334	8	402	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
3T37_A	7.07e-20	3	334	24	418	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
2JBV_A	1.34e-19	3	324	20	409	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	6.75e-36	3	351	53	526	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	6.75e-36	3	351	53	526	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	7.58e-34	3	267	20	336	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.29e-26	3	268	20	331	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.29e-26	3	268	20	331	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QRD92392.1.