CAZyme Information: QRD92278.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD92278.1
• CAZy Family: GH92
• CAZyme Description: putative alpha-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	CP044616|CGC13	76489.44	5.6697

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044616:294832-297049(-)

Full Sequence      

MSKGILKALLPQGNELFYHGPLRFDSAFDKTNLYSYMHHTVTFSYTTAFWTWEDWELELD
WAALRGVNVILAWVGYEKVLLDSLREIGMTDEEILPFFSGPAFQAWNRLGNIQGSWGGHG
VSIAWIEAQFELQKKIVSRIVELGMRPVLPAFPGFVPPAIKRVRPHATVVNGSQWSGFQK
KFTEVSFLSPLDRTFADLQKSVISRQMRAFGNITHVYALDQFNEINPASGELGYLRNLSL
HTWQSLKAVNPAAVWMMQGWLFYDKKDFWDSNRISAYLSGVERNDDMLILDLYSESKPQW
QRTESYFGKPWIWCQLHDFGGNMGMYGQIMNITSDPIEALNKSDSLVGFGLTMEGQEGNE
IVYDLLLDQAWSATPIDTRAYFQSWVRSRYSGNLSVPNELYTAWDLLRKTVYNNTNLTTY
SVTKSIFEISPDIAGLVGRVGHYPTPTSINYDPMVLNEVLSLFMNATRKEPSLWHNPAYE
YDMVDITRQLMGNAFVNVYSVLITSWKSETENRTTKVTSHSERLLNLLSAIDKVLSCNEN
FSLATWISSARDWGNTTETKDFFEYNARNQITLWGPTGEISDYASKAWAGLISSYYKPRW
SIFVDYLGEKNQTSYNETELKAKLHGFEMSWQGQSREPGISWANSSCRGLEVVLRNVSQS
WPSIFGDRA

Enzyme Prediction     

No EC number prediction in QRD92278.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	34	636	2.6e-201	0.8808446455505279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	40	373	6	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	1.04e-84	381	634	1	241	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92278.1|GH89	0.0	1	669	1	669
QMW36661.1|GH89	0.0	10	635	132	757
QMW48717.1|GH89	0.0	10	635	132	757
BAE66022.1|GH89	0.0	37	669	1	633
UDD65982.1|GH89	0.0	1	638	5	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	6.12e-113	32	607	104	659	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.19e-85	42	642	277	839	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.36e-85	42	642	285	847	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.23e-84	42	642	300	862	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	2.16e-114	34	603	156	747	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	2.66e-113	32	607	127	682	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000006

TMHMM  Annotations     

There is no transmembrane helices in QRD92278.1.