CAZyme Information: QRD91240.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD91240.1
• CAZy Family: GH72|CBM43
• CAZyme Description: GDSL-like lipase/acylhydrolase domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	CP044617|CGC2	45674.51	4.7661

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044617:416337-418088(-)

Full Sequence      

MRFSLLSLAWAFQAAATILENGQERLNPYPGQAEQVSVDDSWKSYGADASEISYKGRWDS
TYTSWWSVPGVKFGFTGDKLAVSFGEHTSKDVLVAYRIGGLDWEFSNVTANSAYQFVEPG
SSALNETEYTDHKTFELRVQIDSVYVASDARLVKAAEFNRTVEIIGDSLASGQYATYEGL
ASWGFNFAAGLGNAEYTITAYPGICLVDKQCYGGDARGMTYQWSRASDVGDRANAAFGDK
PEAWNFTAHRVADLVIINLGTNDARTVNNVPSDDYYQSYVKMVENVHGVWPDAQIVLMSL
WGNFIKSGSTWVQETIYESEVQKVYQHFEKNGYVHYFDTKGILQHNDISPGGHPTDFGHL
KIASHLMQWTKIKLGWEFGATGPEVQHDTTYWNNQDSYKRSVFSDPFI

Enzyme Prediction     

No EC number prediction in QRD91240.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	163	368	8.7e-24	0.9760765550239234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	5.61e-49	162	371	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	5.58e-15	162	368	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.83e-11	164	359	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
225353	TesA	1.58e-05	160	377	9	214	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
395531	Lipase_GDSL	0.001	250	366	77	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34907.1|CE0	7.37e-315	1	408	1	408
QMW46983.1|CE0	7.37e-315	1	408	1	408
QRD91240.1|CE0	7.37e-315	1	408	1	408
UDD63953.1|CE0	1.04e-264	1	402	1	369
BCS17295.1|CE0	1.53e-173	1	398	1	400

PDB Hits     

QRD91240.1 has no PDB hit.

Swiss-Prot Hits     

QRD91240.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000938	0.998998	CS pos: 16-17. Pr: 0.7953

TMHMM  Annotations     

There is no transmembrane helices in QRD91240.1.