CAZyme Information: QRD91206.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD91206.1
• CAZy Family: GH72
• CAZyme Description: putative cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	CP044617|CGC3	23073.43	6.8619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044617:333799-334591(+)

Full Sequence      

MVMLRSLLVSALAALAAASPIAEPADQSLEARQLGSSNDLTNGACKDVTLIFARGSTEMG
NMGTVIGPPLCSALKSKLGADKVACQGVGGLYTGGLMQNALPQNTDPGAISTAKSLFEQA
STKCPNTQIVAGGYSQGSAVIDNAVQQLSAEVKDKVKGVVFFGFTRNLQDKGQIPNYPKD
NVKVFCAMGDLVCDGTLIVTAAHLTYTINAPEAASFLASKVQSA

Enzyme Prediction     

EC	3.1.1.74:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	44	220	1.2e-44	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.30e-60	44	221	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91206.1|CE5	5.46e-154	1	224	1	224
QMW34880.1|CE5	5.46e-154	1	224	1	224
UDD63915.1|CE5	2.22e-153	1	224	1	224
QMW46952.1|CE5	6.37e-153	1	224	1	224
BAM28634.1|CE5	6.37e-153	1	224	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	1.55e-71	29	221	5	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	6.02e-69	34	221	1	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
1CUB_A	2.51e-64	20	223	2	209	Chain A, CUTINASE [Fusarium vanettenii],1CUC_A Chain A, CUTINASE [Fusarium vanettenii],1CUD_A Chain A, CUTINASE [Fusarium vanettenii],1CUD_B Chain B, CUTINASE [Fusarium vanettenii],1CUD_C Chain C, CUTINASE [Fusarium vanettenii]
1CUG_A	2.51e-64	20	223	2	209	Chain A, CUTINASE [Fusarium vanettenii]
1CUA_A	3.55e-64	20	223	2	209	Chain A, CUTINASE [Fusarium vanettenii],3EF3_A Chain A, Cutinase-1 [Fusarium vanettenii],3ESA_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESA_B Chain B, Cutinase 1 [Fusarium vanettenii],3ESB_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESC_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESD_A Chain A, Cutinase 1 [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NCM8|CUTI3_ASPFN	9.69e-155	1	224	1	224	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_039350 PE=3 SV=1
sp|Q2U199|CUTI3_ASPOR	1.13e-153	1	224	1	224	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1
sp|A2R2W3|CUTI1_ASPNC	1.56e-109	4	223	4	226	Probable cutinase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An14g02170 PE=3 SV=1
sp|Q0CNE3|CUTI3_ASPTN	1.32e-100	4	222	3	218	Probable cutinase 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_04791 PE=3 SV=2
sp|Q5AX00|CUTI3_EMENI	5.65e-98	5	221	4	219	Cutinase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000276	0.999691	CS pos: 32-33. Pr: 0.3846

TMHMM  Annotations     

There is no transmembrane helices in QRD91206.1.