CAZyme Information: QRD90948.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD90948.1
• CAZy Family: GH62
• CAZyme Description: cellobiose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		90846.92	4.6580

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044618:4437986-4441016(+)

Full Sequence      

MDPRAGCRAICIGAFVLVSSVGAIVYLGLDPADVKCCHSSSELNPWALFIMKLVNRLLAS
FLSVSTVLQSCWAQSGTPVAYTDTETGITFDTWSVPAGTGTGGLVFGVALPGSALTTDAT
EFIGYLQCASQNASSAGWCGISLGGGMNNNLLFLAYPYEDTVLTSLRFGSGYSMPGVYTG
NANVTQISSSINATHFTLLFRCENCLTWDQNGQTGNATTSKGRLVLGWAQSTESPSNPSC
PDNISLVQHDNQGIISATLDENAASVSYEDWVKLANKTVPGDCSGDGGGGTEPTPVPVPD
GATYDYIVVGGGAGGIPVADRLSEAGHSVLLIEKGPPSSGRWGGTMKPSWLDDTNLTRFD
VPGLCNQIWVDSNGIACSDTDQMAGCVLGGGTAVNAGLWWRPNPVDWDYNFPEGWQSSDM
QAPADRVFSRIPGTTTPSTDGKLYYQQGADILFNGLQSAGWSSVTLNDVPAQKTKTFGHA
PFMFSGGERGGPMGTYLVSASERDNFARWSNTTVKRVVREGGRITGVEVEATLNGGYAGT
VNVTANTGRVILSAGTFGTPKVLMRSGIGPKDQLSIVKNSTDGETMIAESEWIELPVGEN
LVDHVNVSVKRTGEVAIMLIRCLQTDVVVTHPDVVFYDFKAAYKTPIESDATSYLNDRTG
IFAQAAPNIGPIIFDEVTGSDGIKRQIQWTARVEGGHDTPDGHAMTISQYLGRGSTSRGR
MTITAGLDTVVSTLPFLRDESDVNAVIQGIQNLKMALNGTGFTWNYPSRNTSIAEFVKTM
PITAGTRRANHWMGTCKIGTDDGRTGGSAVVDLNTKVYGTDNLFVVDASIFPGMITTNPS
AYIVTVAEHAAEKILAL

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	299	857	3.2e-237	0.9762773722627737
AA8	81	271	4.9e-68	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	7.40e-73	81	265	1	175	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	6.58e-50	80	259	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
225186	BetA	2.81e-41	321	856	25	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.64e-31	321	852	18	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	9.64e-24	716	850	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90948.1|AA3_1|AA8	0.0	1	857	1	857
QMW31885.1|AA3_1|AA8	0.0	28	857	32	843
UDD60845.1|AA3_1|AA8	0.0	28	857	32	843
QMW43910.1|AA3_1|AA8	0.0	28	857	32	843
BAE61169.1|AA3_1|AA8	0.0	51	857	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	0.0	78	857	5	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	0.0	78	856	4	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	7.04e-252	301	857	5	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	2.82e-108	304	857	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	3.27e-108	304	857	8	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.93e-134	81	857	24	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	2.82e-20	303	855	4	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	4.78e-20	304	855	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	4.55e-19	304	855	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|P0DO29|ERIK_HERER	5.25e-19	303	854	33	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000000

TMHMM  Annotations     

Start	End
7	29