CAZyme Information: QRD90936.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD90936.1
• CAZy Family: GH6
• CAZyme Description: pectin lyase fold/virulence factor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	CP044618|CGC18	44024.20	4.0003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044618:4401073-4402522(+)

Full Sequence      

MRLTPSLISCLSLLHFTSALVAFPGAEGFGANAVGGRQGEVYVVSNLNDSGEGSLRDAVS
QPGRIVVFSVGGVIEITDRIVVSKQVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIRI
RMGKGGSSGKDAMGIADGKNMIFDHVSVSWGRDETFSINGDVSNVTIQNSIIAQGLETHS
CGGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVIYNWGGGGGYIAGGSDGESNVN
VIGNYFISGPDTSVTAFTRGNENFHAYVETNYYDSDKDGTLNGSELGVDSTNYGGMDLVT
EKYDYPAVASVLSPDDALTYVTKYAGASKVRDSVDTQLVAQVESYGKDGALISDEADMGG
AGDLDQGTTPTDTDGDGIPDDAEAELGTDPNTADSMDLDTSGYTFLEVWANSLVPSSYA

Enzyme Prediction     

No EC number prediction in QRD90936.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	71	246	4.4e-56	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	1.65e-07	22	330	30	344	Pectate lyase [Carbohydrate transport and metabolism].
408654	TSP3_bac	1.80e-04	372	393	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90936.1|PL1_2	1.17e-303	1	419	1	419
QMW31873.1|PL1_2	1.17e-303	1	419	1	419
QMW43898.1|PL1_2	4.75e-303	1	419	1	419
BAE61182.1|PL1_2	4.55e-301	1	419	1	419
UDD60834.1|PL1_2	7.54e-300	1	419	1	419

PDB Hits     

QRD90936.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NQQ7|PLYC_ASPFN	2.07e-304	1	419	1	419	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
sp|Q2UB83|PLYC_ASPOR	8.08e-302	1	419	1	419	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
sp|A1DPF0|PLYC_NEOFI	3.09e-242	5	418	6	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|Q0CLG7|PLYC_ASPTN	8.52e-242	1	418	1	418	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	7.24e-241	5	418	6	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000510	0.999449	CS pos: 19-20. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in QRD90936.1.