CAZyme Information: QRD89467.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD89467.1
• CAZy Family: GH36
• CAZyme Description: chitin synthase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502	CP044618|CGC4	58324.75	7.5104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044618:291355-292933(-)

Full Sequence      

MPFIGAGVVMNIAMIIALLVNLLYRWCYPEKPLIPETPESLVHLIPCYNETKDEMERSLN
SLIMQKGISDHRRCIMIICDGKARGYGMEKTTGEYLLEDILIQKDYRVRITKAYLAWDQQ
FMDVEVQRGTYNDVPYFCIIKQHNQGKRDSLIAVRSFLYNYNIRHTHPETIFTSTFFVHM
ASFIKESGIDYIDNLIGMDADTVFDDHCISELLRCSRYEDTVGVCGYVAVDWKDNFWHPW
KLYQSAEYTIAQCLRRLHQSVITHKVSCLPGCCQLLKICEETCGREVLFKRFGYCPVPTD
GVLRHVRATASEDRNHVCHMLSARPRAQTRQALHAVAYTDVPQSWPVFLSQRRRWTLGAT
SNDLFLSSAPGVHWFERILACTNVMTWFLNVFIFASMARFIMAMFYVEAWIIFCFIAIAL
IPIVYYLIIPFWHIKPWRDASRFWIGCLIYIICGPFVNIAILLYSCHYLDSFGWGKTRQV
VAEDNRDENGQATERTSLLPRT

Enzyme Prediction     

No EC number prediction in QRD89467.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	141	494	2e-28	0.6736242884250474

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	3.42e-29	44	494	30	509	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	6.51e-19	44	356	2	238	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.01e-10	1	474	18	395	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.84e-10	44	288	2	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89467.1|GT2	0.0	1	502	1	502
QMW30587.1|GT2	0.0	1	502	140	641
QMW42640.1|GT2	0.0	1	502	140	638
UDD59401.1|GT2	0.0	1	502	140	641
BAE60326.1|GT2	0.0	1	502	140	605

PDB Hits     

QRD89467.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13395|CHS6_USTMA	3.34e-25	45	483	413	862	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VF17|CHS4_CRYNH	1.46e-23	45	486	512	964	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|J9VNT4|CHS5_CRYNH	1.12e-18	35	486	1248	1711	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|Q4P9K9|CHS8_USTMA	7.78e-17	45	483	1271	1720	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|P30573|CHS3_CANAX	3.49e-15	42	489	665	1139	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
4	23
383	405
409	431
443	465