CAZyme Information: QRD89155.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD89155.1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471		53556.75	6.5496

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044619:5961298-5962713(+)

Full Sequence      

MQARYYPFQWRQSTAVTAVAASLLLIFAVFLFNSRHHIDISPIPNAQPPSYFSNSSACHV
DLDLLRTHASNSSAEYARLEISVVRTKNFTGFSDALDVPIPTYQTVQLDTTNHTELLPEE
RCTTSVTIHAPVAAPRPNASHLIFGVATSTERLYDSLDAFAHWAGGTNAHIVAVVDDEGS
VTQSKKRAKELDIRLTVIQNSDDLLDRYFSLIRTLFERKDELTKWIVLIDDDTFFPSMTN
LVERLATYDPAEPQYIGALTEDIMQMYHGSHMAYGGAGIFLSIPLVRQLNAVFRNCYDFK
GAGDRMIARCIYSHTTTKLKWEPGLHQLDLRGDASGFYESGRPLPLSLHHWKSWFHADMV
ALSKVAAICGEACLLRRWELSDDWYLINGFSVVKYSLPLQDPNSMEQTWDKSKYKGPDPF
EYSLGPLRSKDEDKVSFRLKEAIAETDRVRQIYVRKQEKPQVIEVVWNLRH

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.45e-18	224	350	212	341	hypothetical protein; Provisional
398362	DUF604	2.44e-14	266	350	3	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	3.32e-04	224	296	86	166	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89155.1|GT31	0.0	1	471	1	471
BAE54694.1|GT31	0.0	1	471	1	471
QMW24933.1|GT31	0.0	1	471	1	471
UCK57270.1|GT31	0.0	1	471	1	471
QMW36933.1|GT31	0.0	1	471	1	471

PDB Hits     

QRD89155.1 has no PDB hit.

Swiss-Prot Hits     

QRD89155.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000001

TMHMM  Annotations     

Start	End
13	32