CAZyme Information: QRD88907.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD88907.1
• CAZy Family: GH3
• CAZyme Description: Six-hairpin glycosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	CP044619|CGC34	75044.74	6.0721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044619:5263649-5265812(-)

Full Sequence      

MAKMALGYRLPLLVSLLALFQFALAQKCWRNVTCTGPKDSAFPGLWEENIYAPSSRTVSP
KRKILSLARPNATVDYQKSKPYTLNGNGSAVVFDFGIEVGGIVTLDYTSKGGSGALGLAF
SEAKNWIGEWSDSSNGAFGPDGALYANFTKDGSASYVMPDKSLRGGFRYLTVFLVTEDQV
SVDVDAVSLEIGFQPTWSNLRAYQGYFHSNDDLLNRIWYSGAYTLQTNAVPVNTGRQVPM
LKKGWANNATMGPGDTILVDGAKRDRAVWPGDMGVAVPAAFVSTGDLESVKNALQTMYDT
QDKTTGAFDESGPPLSQKDSDTYHMWSMVGTYNYLLYTNDTSFLSKNWNKYQKAMDYIYN
KVDNSTGLLNVTGTRDWARWQQGYNNSEAQMILYHTLTTGAQLASWAGSSSLTDKWNAQA
TDLVQSINEYCWDDEYGAFKDNATATALHPQDANSLALLYGIVDPDRASRISKNLLQNWT
PIGAETPELPNNISPFISSFEIQGHFKIGQTARALELIRRSWGWYLNNPNGTGSTVIEGY
LVDGSFGYRSDRGYSHDPSYVSHAHGWSAGPTNALTTYVLGLSITSPRGLTWKIAPQFGD
LKTVEGGFTTSLGKFQASWDKSPDGYTLQFSVPPGTKGNLTLPYVRSSEKPSITIDGNNI
NKGVYYVDDTATITVSGGGSHRVVVS

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	88	642	1.4e-100	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	6.83e-12	205	475	4	251	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	3.45e-07	591	643	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
283786	GDE_C	6.84e-05	269	486	31	271	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
273702	oligosac_amyl	1.88e-04	317	493	351	525	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
226800	COG4354	4.27e-04	332	471	452	609	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88907.1|GH78	0.0	1	686	1	686
UCK57529.1|GH78	0.0	1	686	1	686
QMW37218.1|GH78	0.0	4	686	1	674
QMW25160.1|GH78	0.0	4	686	1	674
BAE54925.1|GH78	0.0	4	686	1	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	8.30e-23	91	665	194	715	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

QRD88907.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000192	0.999784	CS pos: 25-26. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in QRD88907.1.