CAZyme Information: QRD88228.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD88228.1
• CAZy Family: GH28
• CAZyme Description: nucleotide-diphospho-sugar transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	CP044619|CGC2	41218.01	6.4980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044619:3249159-3250229(+)

Full Sequence      

MESLGWLLRRAWSSFITLLNFVWLHPFLSFFTTSLFFLLISLTHSFVEFSDNLKTHSLSL
DNFSPAYVTALNESINLGQPIQFDAADNKTSPASIPRIIHRTYKTEDIPSHWKGTYESCR
VLNPTYEQYFWTDESSRQFIETHFDWFLPTYDAYPYNIQRADAIRYFLLWHYGGVYIDMD
IACRRPLDPLLDFSAWMPKTQPYGVSNDLMASTPGHPFITKLALSLHDHDGFYLSKYITV
FFTTGPMYLSSILTEWFRKVQDGPGEEITMPHGVAILPSMMYDTTAYSFFGHAPGSTWHG
NDVAAVSYVYKHWREFCLGAVALGLLVLTIYMLRVRRRRSKYTLILDRQDEEAGLA

Enzyme Prediction     

No EC number prediction in QRD88228.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	111	191	1e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.91e-51	31	313	17	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.86e-25	109	194	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.009	113	237	66	195	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88228.1|GT32	8.25e-272	1	356	1	356
QMW37845.1|GT32	8.25e-272	1	356	1	356
QMW25762.1|GT32	8.25e-272	1	356	1	356
BAE56144.1|GT32	2.37e-271	1	356	1	356
UCK58225.1|GT32	3.10e-227	59	356	35	332

PDB Hits     

QRD88228.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	5.63e-68	93	331	55	288	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	2.42e-63	87	312	47	265	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.63e-62	71	312	54	295	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	4.50e-60	84	341	50	304	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	1.38e-56	40	312	13	273	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999585	0.000428

TMHMM  Annotations     

Start	End
21	43
316	335