CAZyme Information: QRD87112.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD87112.1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	CP044619|CGC26	57691.04	5.3333

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044619:287891-290088(-)

Full Sequence      

MGRRTPVYRAAQTCILGLILLSFASASSYLPRESPTGIISNDGFSFLNETSQLTPRDEKP
FTLRIMPLGASITYGYQSTNGNGYRRWLRQQLRHAGWWVNMVGSNPNDTSTMNDNEVEAT
SGFRVDQVTQQAERPIPQQPNLILINAGTNDANQYHDTTVDVYKTGERMGALLKRLFDAI
PGTTIILRETNKWRLEALHPCLQEHWSRRHSGDGVYCCDIRGTGADDYVWISSEGQGYLY
GNVHDPPVWKPEGIEIFNVKKDRKSLHLADIDGDGKDTGEAEIWLNKWSDNAQGDYFQYK
GVLTGNARCTQGWGVGLYDLGLRFADLDGDGRADYLCMDPDGRTDGWLNKGENSFESIGQ
VKRSEHYDRANHRWADVNGDRMADFLWIDKFNGDTKVTSSMWHLKSTIAGYVKVWINQGP
VPTLDSKWRCGPQDGPRYMGADRGANMHFPNLGGLGRADYHQVIPRTNIAYTWFNECPNE
ALDDDDSTEDPKLPQYPAPAQPASINNNGANDAM

Enzyme Prediction     

No EC number prediction in QRD87112.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	63	194	4.3e-35	0.6494845360824743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.85e-15	63	187	1	84	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	4.07e-08	68	190	2	108	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.71e-07	68	187	4	111	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404411	VCBS	5.69e-07	326	387	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
395531	Lipase_GDSL	1.33e-04	65	200	1	145	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56943.1|CE0	6.98e-107	212	502	597	870
CCT73237.1|CE3|GH43_30	2.08e-57	209	496	625	900
AEO70515.1|CE3	5.45e-56	213	468	630	882
BAE62547.1|CE3	7.18e-53	7	387	7	305
CAP86338.1|CE3	2.68e-47	1	187	1	171

PDB Hits     

QRD87112.1 has no PDB hit.

Swiss-Prot Hits     

QRD87112.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000531	0.999417	CS pos: 26-27. Pr: 0.9744

TMHMM  Annotations     

Start	End
7	29